Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR58 IGR55 IGR54 IGR57 IGR56 IGR59 IGR53 IGR52 HD0070 HD0069 napD, - HD0073 napB, - HD0078 napF, - HD0072 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 murB, - HD0081 napA, - HD0074 HD0070 HD0069 napD, - HD0073 napB, - HD0078 napF, - HD0072 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 murB, - HD0081 napA, - HD0074 HD0070 HD0069 napD, - HD0073 napB, - HD0078 napF, - HD0072 napC,nirT,nrfH, - HD0079 napH, - HD0077 napG, - HD0076 murB, - HD0081 napA, - HD0074
* Calculated from Protein Sequence

Gene ID: HD0074

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
napA  

Definition:
periplasmic nitrate reductase precursor

Gene Start:
61705

Gene Stop:
64200

Gene Length:
2496

Molecular Weight*:
93605

pI*:
7.90

Net Charge*:
8.48

EC:
1.7.99.4  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Nitrogen metabolism

Comment:
For other "nap" genes, see HD0072 (napF), HD0073 (napD), HD0078 (napB), HD0077 (napH), HD0076 (napG), HD0079 (napC).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to NapA proteins. Residues 5-831 are 80% similar to the NAPA protein from P.multocida (12721990). Residues 5-830 are 70% siimilar to NAPA_ECOLI (2506868).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0243
COG name: Anaerobic dehydrogenases, typically selenocysteine-containing
Functional Class: C
The phylogenetic pattern of COG0243 is AMTK-Q-cEBRHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001467 (Prokaryotic molybdopterin oxidoreductases) with a combined E-value of 2.3e-28.
    IPB001467A    83-105
    IPB001467B    114-136
    IPB001467C    508-533
    IPB001467C    241-266


ProDom Summary:  Protein Domain Search
Residues 503-583 are 66% similar to a (OXIDOREDUCTASE SUBUNIT DEHYDROGENASE IRON-SULFUR) protein domain (PD000381) which is seen in NAPA_RHOSH.

Residues 290-333 are 84% similar to a (NITRATE PERIPLASMIC REDUCTASE PRECURSOR) protein domain (PD378631) which is seen in Q9CKL8_PASMU.

Residues 98-179 are 71% similar to a (REDUCTASE OXIDOREDUCTASE SUBUNIT COMPLETE PROTEOME) protein domain (PD213985) which is seen in Q9KLR4_VIBCH.

Residues 37-88 are 84% similar to a (OXIDOREDUCTASE SUBUNIT DEHYDROGENASE IRON-SULFUR) protein domain (PD001047) which is seen in Q9KLR4_VIBCH.

Residues 584-682 are 82% similar to a (PERIPLASMIC NITRATE REDUCTASE PRECURSOR) protein domain (PD017711) which is seen in Q9CKL8_PASMU.

Residues 718-828 are 63% similar to a (REDUCTASE OXIDOREDUCTASE SUBUNIT COMPLETE PROTEOME) protein domain (PD000983) which is seen in Q9I4G3_PSEAE.

Residues 202-493 are 32% similar to a (SUBUNIT FORMATE DEHYDROGENASE) protein domain (PD002479) which is seen in Q9R6U4_SYNP2.

Residues 202-288 are 75% similar to a (PERIPLASMIC NITRATE REDUCTASE PRECURSOR) protein domain (PD017708) which is seen in Q9CKL8_PASMU.

Residues 436-502 are 74% similar to a (PERIPLASMIC NITRATE REDUCTASE PRECURSOR) protein domain (PD266417) which is seen in Q9CKL8_PASMU.

Residues 336-434 are 87% similar to a (PERIPLASMIC NITRATE REDUCTASE SUBUNIT) protein domain (PD412120) which is seen in Q9CKL8_PASMU.



Paralogs:  Local Blast Search
HD0074 is paralogously related to HD1394 (4e-15).


Pfam Summary:  Pfam Search
Residues 41 to 95 (E-value = 2.4e-24) place HD0074 in the Molybdop_Fe4S4 family which is described as Molybdopterin oxidoreductase Fe4S4 domain (PF04879)
Residues 98 to 571 (E-value = 2.5e-118) place HD0074 in the Molybdopterin family which is described as Molybdopterin oxidoreductase (PF00384)
Residues 717 to 825 (E-value = 7.4e-40) place HD0074 in the Molydop_binding family which is described as Molydopterin dinucleotide binding domain (PF01568)

PDB Hit:
pdb|2NAP|A Chain A, Dissimilatory Nitrate Reductase (Nap) From ... 492 6e-140
pdb|1FDO| Oxidized Form Of Formate Dehydrogenase H From E. C... 203 6e-053
pdb|1DMS| Structure Of Dmso Reductase 77 7e-015

Gene Protein Sequence:
VGHIMELSRRDFMKANAAVAAAAAAGIVLPVKNVQADDSGIKWDKAPCRF
CGTGCSVLVGTKDGRVVATQGDPDAEVNRGLNCIKGYFLSKIMYGADRVQ
TPLLRMKDGKFHKEGDFTPVSWDQAFSIMAEKVKATLKAKGGNAVGMFSS
GQTTIFEGYAKVKLWKAGLRSNTIDPNARHCMASAAVAFLRTFGMDEPMG
CYNDIEKTDGFVLWGSNMAEMHPILWSRISDRRLSDNNVKVVVMSTFEHR
SFELADTPIIFKPHSDLAILNYIANYIIQNDKVNWDFVNKHTKFKRGETD
IGYGLRPEHPLQKAAKNVKNAGKMHDSSFEEFKKIVEPYTLEKAHEISGV
PKHQLEALAKMYADPAQKLVSFWTMGFNQHTRGVWVNHMIYNVHLLTGKI
STPGCGPFSLTGQPSACGTAREVGTFVHRLPADMVVMNPKHVEICEKAWK
LPKGTIPTVPGYAAVMQSRMLKDGKLNFLWQMCTNNMQGGPNINEEIFPG
WRNPENFIVVSDPYPSVSAVAADLILPTCMWVEKEGAYGNAERRTQFWYQ
QVKGPAQSKSDLWQIVEFAKYFKAEEVWNEELMAQMPEYRGKTLYEILYL
NGEVDKYQVPTNIPGYLNDEADDFGFYIQKGLFEEYAQFGRGHGHDLADF
ETYHQARGLRWPVVDGKETLWRYREGFDPYVKAGEDFRFYGYPDGKAIIL
GVPYESPAESPDEEYDLWLSTGRVLEHWHTGTMTRRVPELHRSFPNNLVW
MHPSDAKKRGLRHGDKVKVITRRGEMISHLDTRGRNKCPEGLIFTTFFDA
GQLANKLTLDATDPISGETDFKKCAAKVVKA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGGACATATTATGGAACTCAGTCGTAGAGATTTTATGAAAGCCAATGC
TGCCGTGGCAGCTGCCGCTGCCGCAGGAATTGTGCTCCCTGTTAAAAATG
TACAAGCTGATGATAGTGGTATTAAATGGGATAAAGCACCTTGTCGTTTT
TGTGGCACGGGATGTAGTGTGCTAGTAGGGACCAAAGATGGCCGTGTTGT
GGCAACACAAGGCGATCCTGATGCAGAAGTAAACCGAGGTTTAAACTGTA
TCAAAGGATATTTCCTATCAAAAATTATGTACGGTGCTGACCGTGTTCAG
ACACCATTATTGCGAATGAAAGACGGCAAATTTCATAAAGAGGGCGATTT
TACTCCGGTTTCTTGGGATCAAGCATTCAGCATAATGGCGGAAAAAGTAA
AAGCCACTTTAAAAGCAAAAGGCGGTAATGCAGTTGGAATGTTCTCTTCT
GGCCAAACGACTATTTTTGAAGGTTATGCCAAAGTAAAACTTTGGAAAGC
AGGCTTACGCTCAAATACTATCGATCCAAATGCACGGCATTGTATGGCAT
CTGCTGCAGTAGCATTTTTACGCACTTTCGGTATGGATGAACCAATGGGG
TGTTATAACGATATCGAAAAAACAGATGGTTTTGTGCTTTGGGGGTCAAA
TATGGCAGAAATGCACCCCATTTTATGGAGCCGTATCTCTGATCGCCGTC
TTTCGGATAACAATGTAAAAGTCGTGGTTATGTCTACTTTTGAACACCGT
TCATTTGAGTTAGCGGATACGCCGATTATATTTAAACCGCATTCTGATTT
AGCGATTTTGAATTACATTGCCAACTATATTATTCAAAACGATAAAGTAA
ATTGGGATTTTGTTAATAAACATACCAAATTTAAACGCGGTGAAACGGAT
ATTGGCTATGGCTTACGCCCAGAACATCCATTACAAAAAGCGGCGAAAAA
CGTTAAAAATGCTGGCAAAATGCACGATAGTAGCTTTGAAGAATTTAAGA
AAATCGTTGAGCCTTATACATTAGAAAAAGCACACGAAATTTCCGGTGTG
CCAAAACATCAATTAGAAGCATTAGCCAAAATGTATGCCGATCCAGCACA
AAAATTAGTGTCATTTTGGACAATGGGCTTTAATCAACATACACGTGGCG
TATGGGTTAACCATATGATTTATAACGTGCATTTATTAACCGGTAAGATT
TCTACACCAGGTTGTGGGCCATTCTCATTGACAGGTCAGCCTTCTGCTTG
CGGTACAGCACGCGAAGTTGGGACTTTTGTACATCGCTTGCCAGCCGATA
TGGTGGTAATGAATCCAAAACATGTAGAGATTTGTGAAAAAGCGTGGAAA
CTGCCAAAAGGCACCATTCCAACCGTGCCTGGTTATGCCGCGGTAATGCA
AAGCCGTATGTTAAAAGATGGCAAACTTAATTTCTTATGGCAAATGTGTA
CCAATAATATGCAAGGTGGCCCCAATATTAACGAGGAAATTTTCCCGGGT
TGGCGCAATCCTGAAAACTTTATTGTGGTGTCTGATCCATACCCTTCGGT
ATCTGCAGTTGCGGCAGACTTGATTTTGCCTACTTGTATGTGGGTAGAAA
AAGAGGGCGCTTATGGTAATGCGGAACGTCGTACGCAATTTTGGTATCAA
CAAGTAAAAGGTCCGGCACAATCTAAATCTGATTTATGGCAAATTGTTGA
ATTTGCAAAATATTTTAAAGCAGAAGAAGTTTGGAACGAAGAATTGATGG
CACAAATGCCAGAATACCGCGGAAAAACATTGTATGAAATTCTTTACTTA
AATGGTGAAGTAGATAAATACCAAGTGCCAACGAATATTCCCGGTTATTT
GAATGATGAAGCGGACGATTTTGGCTTCTATATTCAAAAAGGGTTATTTG
AAGAATATGCACAATTTGGTCGTGGCCACGGTCACGATTTAGCGGATTTT
GAAACTTATCACCAAGCACGAGGCTTACGTTGGCCTGTCGTCGATGGTAA
AGAGACTTTATGGCGTTACCGTGAAGGTTTTGATCCTTATGTAAAAGCAG
GCGAAGATTTCCGCTTCTATGGTTACCCAGACGGTAAGGCGATTATTCTT
GGCGTCCCGTATGAAAGCCCTGCTGAATCACCCGATGAAGAATACGATTT
ATGGTTATCTACCGGTCGAGTGTTGGAACATTGGCATACCGGCACAATGA
CACGTCGTGTACCTGAATTGCATCGTTCATTCCCGAATAACTTAGTGTGG
ATGCATCCAAGTGATGCGAAAAAACGTGGCTTACGTCACGGTGATAAAGT
GAAAGTGATTACCCGTCGTGGTGAAATGATTTCTCACTTAGACACACGTG
GCCGTAATAAATGCCCTGAGGGATTAATTTTTACGACTTTCTTCGATGCC
GGTCAGCTAGCGAATAAACTTACTTTAGATGCAACGGATCCTATTTCAGG
CGAAACAGATTTCAAAAAATGTGCCGCGAAAGTGGTTAAAGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy