Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR45 IGR46 IGR47 IGR49 IGR50 IGR51 IGR53 IGR52 HD0070 ftpA, - HD0068 HD0066 HD0069 HD0065 glnB, - HD0062 lspA, - HD0063 napF, - HD0072 ccmG,dsbE, - HD0058 mogA, - HD0061 ccmH,nrfF, - HD0060 lytB, - HD0064 HD0070 ftpA, - HD0068 HD0066 HD0069 HD0065 glnB, - HD0062 lspA, - HD0063 napF, - HD0072 ccmG,dsbE, - HD0058 mogA, - HD0061 ccmH,nrfF, - HD0060 lytB, - HD0064 HD0070 ftpA, - HD0068 HD0066 HD0069 HD0065 glnB, - HD0062 lspA, - HD0063 napF, - HD0072 mogA, - HD0061 ccmH,nrfF, - HD0060 lytB, - HD0064 ccmH,nrfF, - HD0059 ccmG,dsbE, - HD0058 ccmH,nrfF, - HD0059
* Calculated from Protein Sequence

Gene ID: HD0066

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
56936

Gene Stop:
55563

Gene Length:
1374

Molecular Weight*:
50955

pI*:
9.50

Net Charge*:
9.24

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 10-457 are 26% similar to 17986684 hypothetical protein [Brucella melitensis] and 25% similar to >23502486 hypothetical protein [Brucella suis 1330].

COGS Summary:  COGS Search
BeTs to 5 clades of COG1752
COG name: Putative phosphoesterases, homologs of neuropathy target esterase
Functional Class:  R
The phylogenetic pattern of COG1752 is ----yqv-EBR------l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0066 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 62 to 308 (E-value = 5.4e-16) place HD0066 in the Patatin family which is described as Patatin-like phospholipase (PF01734)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKLPQTLSLKKCVAYLAITMLSACHLVNYTPVQTIKHITPNEGYRLHHAM
LNSSDDGNLIILMFSGGGARAASLGYGVLEELKKTKVKSTSRGKSLLDQI
DIVYGVSGGSVLASYFALEGRDTIPKFEENFLKNNFQEAVINNIFSFSNL
KRLLSPQFGRGELLQEQFNVALYKGRTFNDLVKERKGPFAVISATDMNAG
QKITFIQDMFDGLCLNLNDLEIARAVAASSSVPLIFTPLTLNNNGGHCSF
KIPKEYIVHKKTQGNGLKTQTVEEVEHTLSAYQNSEERPFIHLVDGGLTD
NIGLASLLEKSEVTGMEQIYKQIQKTNLHNIIVINVNAQNQVMNDIDKSP
NIPSLKNVFNTIVNIPINNTTQLTLRRFREFTDAWNKQIEKTTGKKITIH
FVSLNMKDLPEGQLKQDVLNIGTSFYLPSDDVNKLRRAAAILLKQSPEYQ
KALQSLQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTACCTCAAACTCTAAGTCTGAAAAAGTGTGTAGCATATTTAGC
GATAACTATGCTTTCCGCTTGCCATCTTGTCAACTATACCCCCGTACAAA
CCATTAAACATATTACGCCAAATGAGGGCTATCGATTACACCACGCTATG
TTAAACAGCAGTGATGATGGCAATCTAATCATTTTAATGTTTTCTGGTGG
CGGAGCGCGCGCTGCTTCTCTAGGTTACGGCGTCTTAGAAGAATTAAAAA
AGACCAAAGTTAAATCAACGTCTCGAGGTAAGTCGCTATTGGATCAAATC
GATATAGTCTATGGAGTATCTGGTGGTTCAGTATTAGCGAGCTATTTTGC
TTTAGAAGGACGAGACACTATTCCTAAATTTGAAGAAAATTTTCTCAAGA
ACAACTTCCAAGAAGCCGTTATCAACAATATTTTTAGCTTTTCCAACCTT
AAGCGCCTGCTTTCTCCACAATTTGGCCGCGGAGAATTGTTACAAGAACA
GTTTAATGTTGCCCTTTACAAAGGTAGAACTTTCAATGATTTAGTCAAAG
AACGCAAAGGTCCTTTTGCAGTAATTAGTGCCACAGATATGAATGCAGGC
CAAAAAATAACATTTATTCAAGATATGTTTGACGGTTTATGCCTCAACTT
AAATGATTTAGAAATCGCGCGAGCAGTCGCCGCTTCAAGTTCCGTGCCAT
TAATCTTTACACCGCTTACGCTCAATAATAATGGCGGGCACTGCTCCTTT
AAAATCCCCAAAGAATATATCGTACACAAAAAAACACAGGGAAATGGTTT
AAAAACGCAAACCGTTGAAGAAGTAGAACATACGCTTTCTGCTTACCAAA
ATAGTGAAGAAAGACCGTTTATACATTTAGTTGATGGTGGATTAACTGAT
AATATAGGCTTGGCAAGTTTGCTTGAAAAATCTGAAGTAACGGGCATGGA
GCAAATCTATAAACAAATTCAAAAAACGAATTTACATAATATCATCGTAA
TTAATGTGAATGCGCAAAACCAAGTAATGAACGATATTGATAAAAGCCCA
AATATTCCTAGCTTAAAAAATGTGTTTAATACCATTGTTAACATTCCAAT
CAATAACACTACACAGCTTACGTTACGCCGTTTTAGAGAGTTTACAGACG
CGTGGAATAAACAAATCGAAAAAACTACCGGTAAAAAAATCACCATACAT
TTTGTTAGTTTAAATATGAAAGACTTACCCGAAGGGCAATTGAAACAAGA
TGTGCTGAATATAGGAACCTCTTTCTATTTGCCAAGTGACGATGTAAACA
AGCTACGTAGAGCCGCAGCAATCTTATTAAAACAATCGCCAGAATACCAA
AAAGCCTTGCAATCTTTGCAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy