Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-2 tRNA-Thr-1 tRNA-Tyr-1 IGR45 IGR46 IGR47 IGR49 IGR44 IGR43 IGR50 IGR51 IGR42 ftpA, - HD0068 tufA, - HD0054 HD0066 HD0069 HD0055 HD0065 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 ftpA, - HD0068 tufA, - HD0054 HD0066 HD0069 HD0055 HD0065 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 ftpA, - HD0068 tufA, - HD0054 HD0066 HD0069 HD0065 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 coaA, - HD0056 ccmH,nrfF, - HD0059 ccmH,nrfF, - HD0059 HD0055 coaA, - HD0056
* Calculated from Protein Sequence

Gene ID: HD0063

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
lspA  

Definition:
lipoprotein signal peptidase

Gene Start:
53809

Gene Stop:
54294

Gene Length:
486

Molecular Weight*:
18633

pI*:
9.60

Net Charge*:
2.71

EC:
3.4.23.36  

Functional Class:
Cellular processes; Protein and peptide secretion  

Pathway: pathway table
Protein export

Secondary Evidence:
Cavard D.
Inhibition of colicin synthesis by the antibiotic globomycin.
Arch Microbiol. 1998 Dec;171(1):50-8.
PMID: 9871019

Yu F, Yamada H, Daishima K, Mizushima S.
Nucleotide sequence of the lspA gene, the structural gene for lipoprotein signal peptidase of Escherichia coli.
FEBS Lett. 1984 Jul 23;173(1):264-8.
PMID: 6378662

Yamada H, Kitagawa M, Kawakami M, Mizushima S.
The gene coding for lipoprotein signal peptidase (lspA) and that for isoleucyl-tRNA synthetase (ileS) constitute a cotranscriptional
unit in Escherichia coli.
FEBS Lett. 1984 Jun 11;171(2):245-8.
PMID: 6373377

Yamagata H, Taguchi N, Daishima K, Mizushima S.
Genetic characterization of a gene for prolipoprotein signal peptidase in Escherichia coli.
Mol Gen Genet. 1983;192(1-2):10-4.
PMID: 6227793

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 159 are 59% ( EScore : 9e-54 ) identical to sp|P44975|LSPA_HAEIN LIPOPROTEIN SIGNAL PEPTIDASE between residues 1 and 159 in [Haemophilus influenzae Rd]
Residues 5 to 159 are 45% ( EScore : 1e-35 ) identical to sp|P00804|LSPA_ECOLI LIPOPROTEIN SIGNAL PEPTIDASE between residues 8 and 162 in [Escherichia coli]
Residues 5 to 159 are 42% ( EScore : 1e-33 ) identical to sp|P13514|LSPA_ENTAE LIPOPROTEIN SIGNAL PEPTIDASE between residues 8 and 162 in [Enterobacter aerogenes]
Residues 3 to 157 are 42% ( EScore : 2e-33 ) identical to gb|AAF93848.1| (AE004154) lipoprotein signal peptidase between residues 9 and 165 in [Vibrio cholerae]
Residues 5 to 156 are 43% ( EScore : 9e-33 ) identical to gb|AAF19640.1|AF201388_2 prolipoprotein signal peptidase II between residues 8 and 159 in [Klebsiella pneumoniae]
Residues 3 to 161 are 36% ( EScore : 1e-24 ) identical to sp|O52213|LSPA_SERMA LIPOPROTEIN SIGNAL PEPTIDASE between residues 7 and 163 in [Serratia marcescens]
Residues 12 to 161 are 39% ( EScore : 2e-24 ) identical to emb|CAB83913.1| (AL162753) putative lipoprotein signal peptidase between residues 14 and 163 in [Neisseria meningitidis]
Residues 12 to 161 are 39% ( EScore : 2e-24 ) identical to gb|AAF42167.1| (AE002532) lipoprotein signal peptidase between residues 24 and 173 in [Neisseria meningitidis MC58]
Residues 9 to 157 are 39% ( EScore : 3e-21 ) identical to sp|P17942|LSPA_PSEFL LIPOPROTEIN SIGNAL PEPTIDASE between residues 13 and 163 in [Pseudomonas fluorescens]
Residues 9 to 156 are 37% ( EScore : 2e-16 ) identical to gb|AAF85216.1|AE004050_9 lipoprotein signal peptidase between residues 12 and 161 in [Xylella fastidiosa]

COGS Summary:  COGS Search
BeTs to 11 clades of COG0597
COG name: Lipoprotein signal peptidase
Functional Class:  N
The phylogenetic pattern of COG0597 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001872 (Signal peptidase II/lipoprotein signal peptidase family (A8)) with a combined E-value of 1.1e-13.
    IPB001872    98-121


ProDom Summary:  Protein Domain Search
Residues 10-159 are 60% similar to a (SIGNAL PEPTIDASE II LIPOPROTEIN) protein domain (PD004304) which is seen in LSPA_HAEIN.



Paralogs:  Local Blast Search


HD0063 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 161 (E-value = 3.9e-72) place HD0063 in the Peptidase_A8 family which is described as Signal peptidase (SPase) II (PF01252)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKQSGIKWLWLSLVVITLDLFSKYLVVERFELYESINILPIFNLTYARN
YGAAFSFLADHSGWQKYLFLTLAIIISFILANVLRRNQIDQKRENMAYAL
IIGGAIGNAIDRAYRGYVVDFFDFYWHIYHYPVFNIADVAIVMGAGLLIL
ETFLDKKKKSD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAACAATCCGGAATTAAGTGGCTATGGTTAAGTTTAGTCGTGAT
AACACTAGATCTATTCAGTAAATATTTAGTGGTAGAACGCTTTGAATTGT
ATGAGAGTATCAATATTTTGCCAATATTTAACTTAACCTATGCGCGTAAT
TATGGTGCGGCTTTTAGTTTCTTGGCGGATCATTCTGGTTGGCAAAAATA
TCTATTTTTAACGTTAGCGATCATTATTTCATTCATTTTAGCGAATGTTT
TACGCCGTAATCAAATAGACCAAAAACGTGAAAATATGGCTTATGCGTTA
ATTATCGGTGGTGCAATTGGCAATGCTATTGACCGCGCTTATCGCGGATA
TGTTGTTGATTTTTTTGATTTTTACTGGCATATCTATCATTATCCTGTGT
TTAATATAGCGGATGTTGCTATTGTGATGGGGGCCGGGTTACTGATTTTA
GAGACTTTCTTGGATAAAAAGAAAAAGAGTGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy