Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-2 tRNA-Thr-1 tRNA-Tyr-1 IGR45 IGR46 IGR47 IGR44 IGR43 IGR40 IGR41 IGR39 IGR42 HD0052 HD0053 tufA, - HD0054 HD0055 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 accA, - HD0051 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 HD0055 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 accA, - HD0051 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 glnB, - HD0062 lspA, - HD0063 ccmG,dsbE, - HD0058 mogA, - HD0061 coaA, - HD0057 ccmH,nrfF, - HD0060 lytB, - HD0064 accA, - HD0051 sufI, - HD0050 coaA, - HD0056 ccmH,nrfF, - HD0059 ccmH,nrfF, - HD0059 HD0055 coaA, - HD0056
* Calculated from Protein Sequence

Gene ID: HD0056

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
coaA  

Definition:
pantothenate kinase

Gene Start:
49860

Gene Stop:
50234

Gene Length:
375

Molecular Weight*:
14269

pI*:
10.80

Net Charge*:
9.18

EC:
2.7.1.33  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate  

Pathway: pathway table
Pantothenate and CoA biosynthesis

Secondary Evidence:
Song WJ, Jackowski S.
Cloning, sequencing, and expression of the pantothenate kinase (coaA) gene of Escherichia coli.
J Bacteriol. 1992 Oct;174(20):6411-7.
PMID: 1328157

Vallari DS, Rock CO.
Isolation and characterization of temperature-sensitive pantothenate kinase (coaA) mutants of Escherichia coli.
J Bacteriol. 1987 Dec;169(12):5795-800.
PMID: 2824448

Dunn SD, Snell EE.
Isolation of temperature-sensitive pantothenate kinase mutants of Salmonella typhimurium and mapping of the coaA gene.
J Bacteriol. 1979 Dec;140(3):805-8.
PMID: 230178

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 12 to 117 are 69% ( EScore : 3e-36 ) identical to sp|P44793|COAA_HAEIN PANTOTHENATE KINASE between residues 8 and 113 in [Haemophilus influenzae Rd]
Residues 3 to 117 are 50% ( EScore : 3e-28 ) identical to gb|AAF33512.1| (AF170176) 96% identity over 316 amino acids with E. coli pantothenate kinase between residues 1 and 115 in [Salmonella typhimurium LT2]
Residues 1 to 117 are 48% ( EScore : 1e-27 ) identical to gb|AAA76838.1| (M36321) rts gene product between residues 19 and 135 in [Escherichia coli]
Residues 3 to 117 are 49% ( EScore : 1e-27 ) identical to sp|P15044|COAA_ECOLI PANTOTHENATE KINASE between residues 1 and 115 in [Escherichia coli]
Residues 11 to 117 are 52% ( EScore : 3e-27 ) identical to gb|AAA23591.1| (M90071) pantothenate kinase between residues 1 and 107 in [Escherichia coli]
Residues 11 to 117 are 50% ( EScore : 2e-24 ) identical to gb|AAF93493.1| (AE004120) pantothenate kinase between residues 69 and 175 in [Vibrio cholerae]
Residues 12 to 117 are 42% ( EScore : 1e-16 ) identical to sp|O53440|COAA_MYCTU PANTOTHENATE KINASE between residues 8 and 117 in [Mycobacterium tuberculosis]
Residues 12 to 117 are 42% ( EScore : 1e-16 ) identical to sp|Q9X795|COAA_MYCLE PANTOTHENATE KINASE between residues 8 and 117 in [Mycobacterium leprae]
Residues 12 to 117 are 38% ( EScore : 4e-15 ) identical to sp|O86779|COAA_STRCO PANTOTHENATE KINASE between residues 20 and 127 in [Streptomyces coelicolor A3(2)]
Residues 31 to 114 are 38% ( EScore : 8e-09 ) identical to sp|P54556|COAA_BACSU PANTOTHENATE KINASE between residues 3 and 87 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 3 clades of COG1072
COG name: Panthothenate kinase
Functional Class:  H
The phylogenetic pattern of COG1072 is --------Ebrh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-91 are 66% similar to a (KINASE PANTOTHENATE TRANSFERASE) protein domain (PD015802) which is seen in COAA_HAEIN.



Paralogs:  Local Blast Search
HD0056 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1ESM|A Chain A, Structural Basis For The Feedback Regulatio... 119 1e-028

Gene Protein Sequence:
LAMGLQTTKKITPFLTFDRQQWAKLRKSVPLKLTEQDLKPLLSFNEELSL
EEVSTIYLPLARLINYYIEENIKRQTVLHRFLGVKSPKVPYIISLAGSVS
VGKSTSARILQALLCQWRLSVRWI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCTATGGGCCTGCAAACAACAAAAAAAATCACACCTTTTTTGACTTT
TGACCGTCAACAGTGGGCTAAATTGCGTAAATCAGTTCCATTAAAATTAA
CGGAACAAGATTTAAAACCATTACTTAGCTTTAATGAAGAACTTTCTTTA
GAAGAAGTGAGTACTATTTATTTACCGCTTGCACGTTTGATCAATTATTA
TATTGAAGAAAACATTAAACGTCAGACGGTATTACACCGCTTTTTAGGTG
TGAAATCACCTAAAGTGCCTTATATTATTAGTCTTGCTGGCAGTGTTTCT
GTTGGTAAAAGCACTTCAGCGCGTATTCTGCAAGCGTTGCTTTGCCAGTG
GCGGTTGAGCGTAAGGTGGATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy