Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-2 tRNA-Thr-1 tRNA-Tyr-1 IGR45 IGR38 IGR36 IGR37 IGR44 IGR43 IGR40 IGR41 IGR39 IGR42 HD0052 HD0053 tufA, - HD0054 HD0055 HD0048 ccmG,dsbE, - HD0058 coaA, - HD0057 plsC, - HD0049 ccmH,nrfF, - HD0060 accA, - HD0051 ompA2, - HD0046 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 HD0055 HD0048 ccmG,dsbE, - HD0058 coaA, - HD0057 plsC, - HD0049 ccmH,nrfF, - HD0060 accA, - HD0051 ompA2, - HD0046 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 ccmG,dsbE, - HD0058 coaA, - HD0057 plsC, - HD0049 accA, - HD0051 ompA2, - HD0046 sufI, - HD0050 HD0047 coaA, - HD0056 ccmH,nrfF, - HD0059 HD0055 ccmH,nrfF, - HD0060 HD0048 coaA, - HD0056 ccmH,nrfF, - HD0059 HD0047
* Calculated from Protein Sequence

Gene ID: HD0053

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
possible beta-galactoside

Gene Start:
47808

Gene Stop:
46609

Gene Length:
1200

Molecular Weight*:
46568

pI*:
6.80

Net Charge*:
-2.65

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
One significant hit in gapped blast to hypothetical protein; e.g. residues 2 to 360 are 24% ( Eval: 1e-25 ) similar to pir||JC5898 beta-galactoside alpha-2,6-sialyltransferase between residues 109 and 465 in [Photobacterium damselae]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-361 are 29% similar to a (PROTEOME GLYCOSYLTRANSFERASE COMPLETE) protein domain (PD364620) which is seen in Q9CP67_PASMU.



Paralogs:  Local Blast Search
HD0053 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLIQQNLEIYLDYATIPSLACFMHFIQHKDDVDSIRLFGLARFDIPQSII
DRYPANHLFYHNIDNRDLTAVLNQLADILAQENKRFQINLHLNLFHSIDL
FFAIYPIYQQYQHKISTIQLQLYDDGSEGIVTQHSLCKIADLEQLILQHK
NVLLELLTKGTANVPNPTLLRYLWNNIIDSQFHLISDHFLQHPKLQPLKR
LLKRYTILDFTCYPRFNAEQKQLLKEILHISNELENLLKLLKQHNTFLFT
GTTAFNLDQEKLDLLTQLHILLLNEHQNPHSTHYIGNNYLLLIKGHANSP
ALNHTLALHFPDAIFLPANIPFEIFAMLGFTPNKMGGFASTSYINYPTEN
INHLFFLTSDQPSIRTKWLDYEKQFGLMYSLLAMQKINEDQAFMCTIHN$


Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGATTCAACAAAATCTTGAAATTTATCTTGATTATGCAACTATCCC
AAGCTTGGCTTGTTTTATGCATTTTATTCAACATAAAGATGATGTTGATA
GCATTCGTTTATTTGGTCTAGCACGTTTTGATATTCCACAATCAATTATC
GATCGCTATCCTGCTAACCATTTGTTCTACCATAACATCGATAATCGTGA
TCTTACTGCCGTATTAAATCAACTAGCAGACATTCTTGCCCAAGAGAATA
AGCGCTTCCAGATCAATCTACATTTAAACCTATTTCACAGCATCGACTTA
TTTTTTGCCATTTACCCAATCTATCAGCAATATCAACATAAAATTTCAAC
TATTCAATTACAGCTTTATGATGATGGCTCAGAAGGCATTGTCACCCAGC
ATTCTTTATGTAAAATAGCCGATCTTGAGCAACTGATTTTGCAACATAAA
AATGTATTACTAGAACTGCTTACTAAAGGCACTGCTAACGTGCCTAATCC
TACTTTGCTCCGCTATTTATGGAATAACATTATTGATAGCCAATTTCACT
TGATTTCTGATCATTTCCTCCAGCATCCTAAATTACAACCGCTAAAACGC
TTATTAAAACGTTATACAATTTTAGATTTTACTTGTTATCCTCGCTTTAA
TGCTGAGCAAAAACAACTCCTCAAAGAAATATTGCATATCTCTAATGAGC
TAGAAAACTTATTAAAACTGCTCAAACAGCATAATACTTTTTTATTTACG
GGCACAACCGCCTTTAACTTGGATCAAGAAAAACTTGACTTATTAACACA
ACTACATATTTTGTTGCTTAATGAGCACCAAAATCCCCACTCAACGCATT
ACATTGGCAATAATTATTTATTACTGATTAAAGGCCACGCAAATAGTCCT
GCTTTGAATCATACTTTAGCTTTACATTTTCCTGATGCAATATTCCTGCC
TGCTAATATTCCATTTGAGATCTTTGCAATGCTAGGTTTTACGCCCAATA
AAATGGGGGGCTTTGCTAGCACTAGCTACATTAATTATCCAACAGAAAAT
ATAAATCATCTGTTCTTCTTAACCTCTGATCAGCCGTCTATTCGAACCAA
ATGGTTGGATTATGAAAAGCAGTTTGGCTTAATGTATAGTTTATTAGCCA
TGCAAAAAATCAATGAAGATCAAGCATTTATGTGTACAATACATAATTAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy