Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Thr-2 tRNA-Thr-1 tRNA-Tyr-1 IGR38 IGR36 IGR37 IGR44 IGR43 IGR40 IGR41 IGR39 IGR35 IGR42 HD0052 HD0053 tufA, - HD0054 HD0055 HD0048 ccmG,dsbE, - HD0058 coaA, - HD0057 plsC, - HD0049 accA, - HD0051 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 HD0055 HD0048 ccmG,dsbE, - HD0058 coaA, - HD0057 plsC, - HD0049 accA, - HD0051 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 HD0052 HD0053 tufA, - HD0054 coaA, - HD0057 plsC, - HD0049 accA, - HD0051 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 HD0047 coaA, - HD0056 HD0055 HD0048 ccmG,dsbE, - HD0058 coaA, - HD0056 HD0047
* Calculated from Protein Sequence

Gene ID: HD0051

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
accA  

Definition:
acetyl-coenzyme-A carboxylase subunit a

Gene Start:
45469

Gene Stop:
46422

Gene Length:
954

Molecular Weight*:
35200

pI*:
5.40

Net Charge*:
-6.67

EC:
6.4.1.2  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism
Tetracycline biosynthesis

Secondary Evidence:
Best EA, Knauf VC.
Organization and nucleotide sequences of the genes encoding the biotin carboxyl carrier
protein and biotin carboxylase protein of Pseudomonas aeruginosa acetyl coenzyme A carboxylase.
J Bacteriol. 1993 Nov;175(21):6881-9.
PMID: 7693652

Li SJ, Cronan JE Jr.
Growth rate regulation of Escherichia coli acetyl coenzyme A carboxylase, which catalyzes the first committed step of lipid biosynthesis.
J Bacteriol. 1993 Jan;175(2):332-40.
PMID: 7678242

Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Acetyl-CoA carboxylase protein; e.g. residues 1-316 are 82% similar to (U32724) acetyl-CoA carboxylase, carboxyl transferase of Haemophilus influenzae Rd, residues 1-316 are 71% similar to [281805] acetyl-CoA carboxylase carboxyltransferase alpha chain of Escherichia coli, residues 1-316 are 67% similar to (AE004296) acetyl-CoA carboxylase, carboxyl transferase alpha subunit of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0825
COG name: Acetyl-CoA carboxylase alpha subunit
Functional Class: I
The phylogenetic pattern of COG0825 is a--kyqvceBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR01069 (Acetyl-CoA carboxylase carboxyl transferase alpha subunit signature) with a combined E-value of 3.6e-70.
    PR01069A    89-100
    PR01069B    114-132
    PR01069C    135-151
    PR01069D    154-167
    PR01069E    170-183
    PR01069F    198-207


ProDom Summary:  Protein Domain Search
Residues 60-314 are 83% similar to a (TRANSFERASE ALPHA SUBUNIT CARBOXYLASE) protein domain (PD004951) which is seen in ACCA_HAEIN.

Residues 1-59 are 83% similar to a (TRANSFERASE CARBOXYLASE SUBUNIT ALPHA) protein domain (PD337833) which is seen in Q9CNX9_PASMU.



Paralogs:  Local Blast Search

HD0051 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 149 (E-value = 4.5e-102) place HD0051 in the ACCA family which is described as Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit (PF03255)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSQEYLDFELPIAELEAKIESLRSVCAQDGKIDLEDEINRLQHKSQELTK
KTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEFDELAGDRAFADDKAIV
GGIARLDGRPVMVIGHQKGRVTKEKVKRNFGMPAPEGYRKALRLMEMAER
FKMPIITFIDTPGAYPGIGAEERGQAEAIARNLREMSQLSVPIICTVIGE
GGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKASMAAEVMG
LTAQRLKELNLIDGIVDEPLGGAHRDVLKIAHNLKQQILADLAELDSLTT
EALLERRYERLMSYGYV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCCAAGAATATTTAGACTTTGAATTACCGATTGCTGAATTAGAAGC
AAAAATTGAATCATTGCGTTCAGTTTGTGCGCAAGACGGTAAAATTGATC
TTGAAGATGAAATTAACCGCCTACAACATAAAAGCCAAGAATTAACTAAG
AAAACTTTTGCTAATTTAGATGCGTGGCAAGTTTCTAGAATGGCTCGCCA
TCCAAATCGTCCTTATACTTTAGATTATATCGAACATATTTTTACTGAAT
TTGATGAGTTAGCTGGTGATCGTGCTTTTGCAGATGATAAAGCGATTGTC
GGGGGTATTGCGCGTTTAGATGGTCGCCCTGTTATGGTAATTGGCCATCA
AAAAGGCCGTGTGACTAAAGAGAAAGTAAAACGTAATTTTGGTATGCCTG
CTCCGGAGGGATATCGTAAAGCCTTACGCCTAATGGAAATGGCAGAACGT
TTTAAGATGCCAATCATTACTTTTATTGATACACCGGGCGCTTATCCTGG
TATCGGAGCAGAAGAACGTGGTCAAGCAGAAGCGATTGCGCGCAATTTAC
GGGAAATGTCACAGTTAAGTGTGCCGATCATTTGTACCGTAATTGGTGAG
GGTGGTTCTGGTGGTGCATTAGCAATCGGCGTTGGCGATAAGGTAAATAT
GTTGCAATATTCAACTTATTCCGTTATTTCCCCGGAAGGTTGTGCTTCTA
TTTTGTGGAAAAGTGCCGAGAAAGCATCAATGGCGGCAGAGGTAATGGGC
CTAACGGCACAACGTTTAAAAGAACTTAATTTAATTGACGGTATTGTTGA
TGAACCATTAGGTGGTGCGCATCGTGACGTACTTAAAATTGCACACAATT
TAAAACAGCAGATTTTAGCTGATTTAGCAGAGTTAGATAGCCTCACCACA
GAAGCATTGTTAGAACGCCGTTATGAGCGTCTCATGAGTTACGGCTACGT
TTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy