Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR38 IGR36 IGR32 IGR37 IGR33 IGR30 IGR31 IGR34 IGR35 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0048 HD0043 HD0038 plsC, - HD0049 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 hemN, - HD0037 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0048 HD0043 HD0038 plsC, - HD0049 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 hemN, - HD0037 thdF, - HD0039 yidC, - HD0040 HD0041 HD0042 HD0041 HD0044 HD0043 HD0038 plsC, - HD0049 ompA, - HD0045 ompA2, - HD0046 sufI, - HD0050 hemN, - HD0037 HD0047 HD0048 HD0047
* Calculated from Protein Sequence

Gene ID: HD0044

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
40070

Gene Stop:
39951

Gene Length:
120

Molecular Weight*:
4336

pI*:
10.90

Net Charge*:
6.65

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No hits using gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0044 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHSLSKLAPIKASLLTGKNCNKTYKIIQLHAVSVKMTFH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTCATTATCAAAGTTAGCCCCTATAAAAGCAAGCCTATTAACCGG
TAAAAACTGTAATAAAACGTATAAAATCATACAGTTACACGCCGTTTCTG
TAAAAATGACCTTTCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy