Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR36 IGR32 IGR37 IGR33 IGR30 IGR28 IGR31 IGR34 IGR35 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0048 HD0043 HD0038 plsC, - HD0049 ompA, - HD0045 ompA2, - HD0046 lysA, - HD0036 hemN, - HD0037 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0048 HD0043 HD0038 plsC, - HD0049 ompA, - HD0045 ompA2, - HD0046 lysA, - HD0036 hemN, - HD0037 thdF, - HD0039 yidC, - HD0040 HD0041 HD0042 HD0041 HD0044 HD0043 HD0038 ompA, - HD0045 ompA2, - HD0046 lysA, - HD0036 hemN, - HD0037 HD0047 plsC, - HD0049 HD0048 HD0047
* Calculated from Protein Sequence

Gene ID: HD0040

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yidC  

Definition:
inner membrane protein, 60 kDa (yidC)

Gene Start:
39220

Gene Stop:
37610

Gene Length:
1611

Molecular Weight*:
60669

pI*:
9.00

Net Charge*:
5.81

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Saaf,A., Monne,M., de Gier,J.W. and von Heijne,G.
Membrane topology of the 60-kDa Oxa1p homologue from Escherichia coli.
J. Biol. Chem. 273 (46), 30415-30418 (1998)
Medline: 99023968


Comment:
From GenBank (gi:1168226): In H.influenzae, this protein is an integral membrane protein of the inner membrane that belongs to the OXA1/60 KDa IMP family of proteins.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to 60 kD inner-membrane protein; e.g. residues 1-536 are 65% similar to (U32781) inner membrane protein, 60 kDa (yidC) of Haemophilus influenzae Rd,
residues 1-534 are 55% similar to (AE004093) inner membrane protein, 60 kDa of Vibrio cholerae, residues 1- are 52% similar to (AE000447) 60 KD inner-membrane protein of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0706
COG name: Inner membrane proteins, SpoIIIJ family
Functional Class: S
The phylogenetic pattern of COG0706 is ----yqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00701 (60Kd inner membrane protein signature) with a combined E-value of 2.4e-136.
    PR00701A    2-23
    PR00701B    69-90
    PR00701C    157-177
    PR00701D    210-228
    PR00701E    243-258
    PR00701F    315-335
    PR00701G    406-429
    PR00701H    453-475
    PR00701I    490-513


ProDom Summary:  Protein Domain Search
Residues 331-518 are 60% similar to a (TRANSMEMBRANE PROTEOME COMPLETE) protein domain (PD409339) which is seen in 60IM_BUCAP.

Residues 345-522 are 85% similar to a (MEMBRANE COMPLETE PROTEOME INNER) protein domain (PD002157) which is seen in Q9CLQ2_PASMU.

Residues 60-335 are 63% similar to a (INNER-MEMBRANE PROTEOME COMPLETE) protein domain (PD013985) which is seen in Q9CLQ2_PASMU.



Paralogs:  Local Blast Search
HD0040 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 343 to 527 (E-value = 5.4e-119) place HD0040 in the 60KD_IMP family which is described as 60Kd inner membrane protein (PF02096)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MNSNRSLLVMGLLLVSFLIFTQWQQDFNPEIQAQKQAQQQSRDVPHATNT
ANAITEHMTKGKTITVESDVLRLVIDTLGGDVIESDLLAHKASLDSTDPL
KLLTTEGLIYTAQSGLVGKNGIDTHIGRAPYQVTQDHFTLAKGQNEIVVP
MTFEQDGVMYTKTFTLKRGSYDVAVSFDIQNNSANTIEVQPYGQIKHSLL
DSSGNLAMPTYTGGAYSSSETNYKKYSFDEMTKANLNIDTKGGWVALLQH
YFVSAWVPNQDASNTLYSRTHNGVATIGYRGPITTVKPNTKTTITSQLWT
GPKDQKEMAQAATHLELTVDYGWAWFIAKPLFWLLIFIHSIIGNWGLAIM
GVTLVVKSLLYPLTKAQYTSMAKMRMLQPKLQELRERYGDDRQQMSQEMM
KLYKQEKVNPMGGCLPLILQMPIFIALYWTFMEAVELRHAPFFGWIQDLS
AQDPYYIFPVLMGLSMFLLQKMSPTAVADPTQLKVMTFMPVIFTVFFLWF
PSGLVLYWLTSNCITIVQQWLIYRNLEKKGLHTRKK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTCAAATCGTAGTTTATTGGTAATGGGCTTGCTATTAGTTTCATT
CCTGATTTTCACTCAGTGGCAACAGGATTTTAACCCTGAAATTCAGGCAC
AGAAGCAGGCTCAGCAACAATCAAGAGATGTACCGCACGCAACTAACACT
GCGAACGCGATCACAGAACATATGACAAAAGGTAAAACAATTACCGTAGA
AAGTGATGTTTTACGGTTAGTCATTGATACTTTAGGTGGAGATGTAATTG
AATCCGATTTATTAGCGCATAAAGCAAGCTTAGATTCTACTGATCCACTC
AAATTATTAACGACCGAAGGGCTAATTTATACTGCTCAAAGTGGCTTAGT
CGGCAAAAATGGCATTGATACGCACATTGGTCGTGCGCCATATCAGGTTA
CACAAGATCACTTTACGTTAGCCAAAGGTCAAAATGAAATTGTTGTACCT
ATGACTTTTGAACAAGATGGTGTGATGTATACCAAAACTTTCACACTAAA
ACGTGGTAGTTATGATGTTGCGGTAAGTTTCGATATTCAAAATAACAGTG
CGAACACGATTGAGGTCCAACCTTACGGCCAAATTAAACATTCATTACTG
GATAGTTCTGGTAACCTTGCAATGCCAACCTATACCGGCGGTGCCTATTC
TTCTTCTGAAACAAACTATAAAAAATATAGTTTTGATGAGATGACAAAAG
CAAATTTAAATATTGATACTAAAGGTGGCTGGGTCGCACTATTACAACAT
TATTTTGTTTCTGCTTGGGTGCCAAATCAAGATGCAAGCAATACCCTTTA
CTCTCGCACCCATAATGGCGTTGCCACTATTGGTTATCGCGGTCCGATTA
CCACAGTAAAACCGAATACAAAAACGACTATTACTAGCCAATTATGGACC
GGTCCAAAAGATCAAAAAGAAATGGCACAAGCGGCTACTCACTTAGAGTT
AACCGTAGATTATGGTTGGGCATGGTTTATTGCTAAGCCGTTATTCTGGT
TGCTTATTTTTATCCACAGTATTATCGGCAACTGGGGATTAGCCATTATG
GGCGTTACCCTTGTAGTAAAAAGTTTGCTCTATCCGCTCACTAAAGCACA
ATATACTTCAATGGCAAAAATGCGCATGTTACAGCCAAAATTGCAAGAAC
TACGCGAACGTTATGGCGACGATCGCCAGCAAATGAGCCAAGAAATGATG
AAATTATATAAACAAGAAAAGGTCAATCCAATGGGTGGTTGCTTACCGCT
TATACTACAGATGCCTATCTTCATCGCTTTATATTGGACATTTATGGAAG
CGGTTGAATTACGCCACGCGCCATTCTTTGGTTGGATTCAAGACTTATCA
GCACAAGATCCTTATTATATTTTCCCAGTATTAATGGGATTATCCATGTT
CTTATTGCAAAAAATGTCGCCAACTGCGGTAGCCGATCCAACACAGCTAA
AAGTGATGACCTTTATGCCGGTTATCTTTACCGTCTTCTTCTTATGGTTC
CCATCAGGACTCGTCCTTTATTGGTTAACCTCTAACTGTATTACTATTGT
ACAACAATGGCTTATCTACCGTAACCTTGAGAAAAAAGGTTTACATACTC
GTAAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy