Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR24 IGR25 IGR27 IGR32 IGR33 IGR30 IGR28 IGR31 IGR26 IGR34 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0035 HD0043 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 ompA, - HD0045 lysA, - HD0036 hemN, - HD0037 HD0044 HD0042 thdF, - HD0039 yidC, - HD0040 HD0035 HD0043 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 ompA, - HD0045 lysA, - HD0036 hemN, - HD0037 thdF, - HD0039 yidC, - HD0040 HD0041 HD0042 HD0041 HD0044 HD0035 HD0043 frdC, - HD0033 HD0038 frdB, - HD0032 ompA, - HD0045 lysA, - HD0036 hemN, - HD0037 frdD, - HD0034
* Calculated from Protein Sequence

Gene ID: HD0038

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
35412

Gene Stop:
36011

Gene Length:
600

Molecular Weight*:
21658

pI*:
7.00

Net Charge*:
0.00

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Four significant hits in gapped BLAST to conserved hypothetical proteins; i.e. residues 3 to 199 are 28% (EScore : 9e-09) identical to (U64516) unknown of Shigella dysenteriae, residues 2 to 199 are 27% (EScore : 1e-07) identical to (Y14083) hypothetical protein of Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0702
COG name: Predicted nucleoside-diphosphate-sugar epimerases
Functional Class: M,G
The phylogenetic pattern of COG0702 is ----Yq-CEB-----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 3-199 are 28% similar to a (DOMAIN OF UNKNO N) protein domain (PD415922) which is seen in O70016_SHIDY.



Paralogs:  Local Blast Search
HD0038 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVLLFGANGLAGRQLLTQAVGLQIVSVLRQPSEDPFFSQRQTVIADVMNQ
AECEAVITQTKPRVVISFIGGKKDGVRSDATGNINIINAIKKCAPTARFI
FVTSMGCGEQFDELPASVKQFLGEALAEKTVAEEALRASGLNWTILRPCG
LNTEQGDTFTLSDTKQLPERYMSRKALANAVLSVLDRNDVQHQIFSVTQ$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTACTATTTGGAGCAAATGGCTTAGCGGGTCGTCAGTTACTGAC
ACAAGCGGTTGGACTGCAAATCGTTTCCGTATTACGCCAGCCCTCGGAAG
ATCCCTTTTTTAGTCAACGGCAAACAGTCATTGCCGATGTAATGAACCAA
GCTGAATGTGAAGCGGTGATCACTCAGACTAAGCCACGTGTAGTGATTAG
TTTTATTGGTGGTAAAAAAGACGGTGTACGTAGTGATGCCACGGGTAATA
TCAATATTATCAATGCTATTAAAAAATGCGCACCAACCGCTCGCTTTATT
TTTGTGACCAGTATGGGCTGTGGTGAACAATTTGATGAATTGCCTGCTTC
AGTCAAGCAATTTTTAGGTGAAGCATTAGCAGAAAAAACAGTCGCAGAAG
AGGCATTACGCGCAAGCGGGTTAAATTGGACGATTTTACGCCCATGTGGG
TTAAATACCGAACAAGGCGATACCTTTACGCTAAGTGATACAAAACAACT
ACCTGAACGTTATATGAGCCGTAAAGCTTTGGCGAATGCGGTATTAAGTG
TATTAGATCGAAATGATGTTCAGCATCAGATTTTCTCGGTAACACAATAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy