Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR24 IGR25 IGR23 IGR27 IGR32 IGR30 IGR28 IGR31 IGR26 HD0042 thdF, - HD0039 yidC, - HD0040 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 HD0042 thdF, - HD0039 yidC, - HD0040 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 thdF, - HD0039 yidC, - HD0040 HD0041 HD0042 HD0041 HD0035 frdC, - HD0033 HD0038 frdB, - HD0032 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 frdD, - HD0034
* Calculated from Protein Sequence

Gene ID: HD0037

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
hemN  

Definition:
oxygen-independent coproporphyrinogen

Gene Start:
33596

Gene Stop:
35410

Gene Length:
1815

Molecular Weight*:
67710

pI*:
6.40

Net Charge*:
-6.48

EC:
1.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Henderson,D.P., Wyckoff,E.E., Rashidi,C.E., Verlei,H. and Oldham,A.L. Characterization of the Plesiomonas shigelloides Genes Encoding the Heme Iron Utilization System.
J. Bacteriol. 183 (9), 2715-2723 (2001)
Medline: 21189295.

Comment:
From GenBank (gi:12518212): In E.coli, ChuW is involved in the biosynthesis of cofactors and carriers, specifically heme and porphyrin. It is a possible oxygen independent coproporphyrinogen III oxidase.

From GenBank (gi|13774061): In P.shigelloides, this is a heme utilization protein, HugW.

Note: This protein hits to two groups of proteins in gapped BLAST. The N-terminal >400 residues hit to heme utilization proteins of corresponding size (~370 aa) while the C-terminal >150 residues hit to hypothetical proteins of corresponding size (~165 aa). This protein does not hit to any one protein of its entire length. Hits to the above N-terminal region are entirely exclusive from hits matching the C-terminal region.

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to oxygen-independent coproporphyrinogen III oxidases. Residues 2-427 are 38% similar to this enzyme from Yersinia pestis (16120625|) and residues 54-421 are 39% similar to this enzyme from E.coli (15804047|).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class: H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003401 (Oxygen-independent coproporphyrinogen III oxidase) with a combined E-value of 5.1e-27.
    IPB003401B    54-69
    IPB003401C    105-118
    IPB003401D    141-186
    IPB003401E    201-245


ProDom Summary:  Protein Domain Search
Residues 471-595 are 36% similar to a (PROTEOME COMPLETE VCA0908 PM0298) protein domain (PD074677) which is seen in Q9KL40_VIBCH.

Residues 62-217 are 35% similar to a (PROTEOME COMPLETE OXIDASE III COPROPORPHYRINOGEN) protein domain (PD000690) which is seen in Q9Z8G3_CHLPN.



Paralogs:  Local Blast Search
HD0037 is paralogously related to HD1668 (9e-21).


Pfam Summary:  Pfam Search
Residues 56 to 228 (E-value = 1.4e-24) place HD0037 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 461 to 602 (E-value = 3e-46) place HD0037 in the DUF1008 family which is described as Protein of unknown function (DUF1008) (PF06228)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MITTIPWKATQAQPNAFPERQALMPVWEGEAIPQAEWQQCWQQAAINVLK
EDGLAYFHIPFCASHCIFCGFYRNAWKEDYSKVYTDKLIEELAYEASIRQ
GNGKIQAVYFGGGTPTALATEDLVRLIKACYQYLPLATDCEFTLEGRISH
FDIEKARACVEAGVNRISIGVQTFNSAIRKRLGRKHSGEEAYAYLQALCE
LDAVIVADLIFGLPNQTDEVWANDINVASGLPLSGLDIYAFNNYPFLPIN
KMIEHGTLPPAASFEVQAQHYAYAVENLQQAGWTQVSNNHFAFPGRGERN
RYNTLVKSNMPCLAFGSGAGGNFSGYSFQVDTTLQTYLDTPADKKALSYL
SKQGPNKQLLGIVQHDLELGYLDIKLFRDNPKAMKLLMQWQQLSLLNIDA
NGIACLNISGRYWSPTLIRKLMLTLPTHDEKEHKMVKLSEQQLAELRQSL
AENPGQILEMVAGMKQCSFEEVISCLPQEMITKTDGSRFVEIMQALATLE
DAVTFIAHTADAIVEVTGKLPSGQIGRGFYNFDHTHEGGVHGHLRYENCA
AIYLLERPFMGKHTVSLNFVNHQGGAMFKIFVGRDAERNLRQNQIDFMRQ
LIKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTACAACAATACCTTGGAAAGCAACTCAAGCACAACCCAACGCCTT
CCCTGAACGTCAAGCCTTAATGCCCGTCTGGGAGGGAGAAGCTATACCTC
AAGCAGAATGGCAACAATGTTGGCAACAAGCGGCAATTAATGTATTAAAA
GAGGATGGTTTAGCTTATTTTCATATCCCATTTTGTGCCAGTCATTGTAT
TTTCTGTGGTTTTTATCGAAATGCTTGGAAAGAAGACTATAGTAAAGTTT
ATACCGATAAATTGATTGAAGAACTTGCTTACGAAGCTTCAATTCGCCAA
GGAAATGGCAAGATTCAAGCGGTGTATTTTGGTGGCGGTACGCCAACGGC
ATTAGCGACAGAAGATTTAGTCCGTTTAATTAAAGCGTGTTATCAATATT
TACCGCTTGCAACAGATTGTGAATTTACCTTAGAAGGCCGTATTAGTCAT
TTTGATATTGAAAAAGCACGTGCTTGCGTTGAAGCCGGCGTTAATCGCAT
TTCGATCGGGGTACAAACATTTAATTCTGCGATTCGTAAACGTTTAGGCC
GTAAACATAGCGGTGAAGAAGCGTATGCTTATTTACAAGCGTTATGTGAA
TTAGATGCGGTAATTGTGGCGGATTTAATTTTTGGCTTACCGAATCAAAC
GGATGAAGTGTGGGCAAATGATATTAACGTTGCCAGTGGTTTACCTTTGT
CAGGTTTGGATATTTACGCATTTAATAATTATCCGTTTTTGCCGATTAAT
AAAATGATTGAACATGGCACATTACCACCGGCGGCTAGCTTTGAAGTACA
AGCTCAACATTATGCTTATGCAGTGGAAAATTTACAACAAGCGGGTTGGA
CACAAGTGAGTAATAATCACTTTGCTTTTCCAGGTAGAGGAGAGCGAAAT
CGTTATAATACTTTAGTTAAATCAAATATGCCGTGTTTGGCATTTGGCTC
GGGAGCAGGCGGTAATTTTAGTGGTTATAGTTTTCAAGTCGATACGACTT
TACAAACCTATTTAGATACGCCAGCAGATAAAAAAGCGTTGTCTTATTTA
AGTAAACAAGGGCCAAATAAACAATTATTAGGCATAGTACAACATGATTT
AGAGCTTGGTTATCTAGATATTAAATTATTTAGAGATAACCCCAAAGCGA
TGAAATTGTTAATGCAATGGCAACAATTATCACTATTAAACATTGATGCT
AATGGCATTGCATGCTTAAATATAAGTGGGCGTTATTGGTCACCTACATT
AATTCGTAAATTAATGCTCACTTTACCAACACACGATGAAAAGGAACATA
AAATGGTTAAATTAAGCGAACAACAATTAGCAGAATTACGTCAATCACTT
GCAGAAAATCCAGGCCAAATTTTAGAGATGGTAGCAGGTATGAAGCAATG
TAGCTTTGAAGAAGTAATTAGCTGTTTACCACAAGAAATGATCACGAAAA
CAGACGGTAGCCGTTTTGTTGAAATTATGCAGGCATTAGCCACGTTAGAA
GATGCGGTAACATTTATTGCACATACGGCAGATGCTATAGTAGAAGTGAC
CGGTAAATTACCAAGCGGTCAAATTGGGCGTGGTTTTTATAATTTTGATC
ATACCCATGAAGGGGGTGTACATGGTCATTTGCGTTATGAAAATTGTGCG
GCTATTTATTTGCTTGAACGTCCATTTATGGGTAAACACACCGTGTCATT
AAACTTTGTCAATCATCAAGGTGGTGCAATGTTTAAAATCTTTGTTGGCC
GTGATGCAGAGCGTAATTTACGTCAGAATCAAATTGATTTTATGCGTCAA
TTAATTAAGGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy