Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR24 IGR25 IGR23 IGR27 IGR21 IGR30 IGR28 IGR26 IGR22 genX, - HD0029 thdF, - HD0039 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 genX, - HD0029 thdF, - HD0039 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 genX, - HD0029 thdF, - HD0039 HD0035 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 frdD, - HD0034
* Calculated from Protein Sequence

Gene ID: HD0035

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
32032

Gene Stop:
32130

Gene Length:
99

Molecular Weight*:
3506

pI*:
9.50

Net Charge*:
1.93

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits using gapped BLAST with a cutoff of 1e-5.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0035 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKKFIFTVLFASVALTACAVKGPLYFPTEQTT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAATTTATTTTTACTGTTTTGTTCGCAAGTGTTGCTTTAACTGC
CTGTGCGGTAAAAGGTCCATTATATTTTCCAACCGAGCAAACAACGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy