Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR29 IGR24 IGR25 IGR23 IGR27 IGR21 IGR30 IGR28 IGR26 IGR20 IGR22 genX, - HD0029 thdF, - HD0039 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 genX, - HD0029 thdF, - HD0039 HD0035 frdD, - HD0034 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 genX, - HD0029 thdF, - HD0039 HD0035 frdC, - HD0033 HD0038 frdB, - HD0032 dapF, - HD0026 lysA, - HD0036 frdA, - HD0030 hemN, - HD0037 frdD, - HD0034
* Calculated from Protein Sequence

Gene ID: HD0033

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
frdC  

Definition:
fumarate reductase 15 kD hydrophobic protein

Gene Start:
31139

Gene Stop:
31525

Gene Length:
387

Molecular Weight*:
14678

pI*:
10.50

Net Charge*:
7.36

EC:
1.3.99.1  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table
Butanoate metabolism
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Reductive carboxylate cycle (CO2 fixation)

Primary Evidence:
NULL

Secondary Evidence:
Cole,S.T.
Nucleotide sequence coding for the flavoprotein subunit the fumarate reductase of Escherichia coli.
Eur. J. Biochem. 122 (3), 479-484 (1982)
Medline: 82138876.

Blaut,M., Whittaker,K., Valdovinos,A., Ackrell,B.A., Gunsalus,R.P. and Cecchini,G.
Fumarate reductase mutants of Escherichia coli that lack covalently bound flavin.
J. Biol. Chem. 264 (23), 13599-13604 (1989)
Medline: 89340438.

Schroder,I., Gunsalus,R.P., Ackrell,B.A., Cochran,B. and Cecchini,G.
Identification of active site residues of Escherichia coli fumarate reductase by site-directed mutagenesis.
J. Biol. Chem. 266 (21), 13572-13579 (1991)
Medline: 91310624.

Iverson,T.M., Luna-Chavez,C., Cecchini,G. and Rees,D.C.
Structure of the Escherichia coli fumarate reductase respiratory complex.
Science 284 (5422), 1961-1966 (1999)
Medline: 99301923


Comment:
From GenBank (gi:1169739): This hydrophobic component may be required to anchor the catalyti components of the fumarate reductase complex to the cytoplasmic membrane.
From GenBank (gi:120489): In E. coli, two distinct, membrane-bound, FAD-containing enzymes are responsible for the catalysis of fumarate and succinate interconversion; the fumarate reductase is used in anaerobic growth and the succinate dehydrogenase is used in aerobic growth. Catalytic activity of this protein in E. coli is: succinate + acceptor = fumarate + reduced acceptor, requiring FAD (covalently linked) as a cofactor. Fumerate dehydrogenase forms part of an enzyme complex containing four subunits: a flavoprotein (HD0030), an iron-sulfur protein (see HD0032), and two hydrophobic anchor proteins (see HD0033 and HD0034).

Blast Summary:  PSI-Blast Search
Several significant hits in gapped BLAST to fumarate reductase 15kD hydrophobic proteins; e.g., residues 3-128 are 57% similar to FRDC_HAEIN [1169739], residues 1-128 are 43% similar to FRDC_PROVU [1346037], and residues 1-123 are 42% similar to FRDC_ECOLI [120495].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB003510 (Fumarate reductase subunit C) with a combined E-value of 1.4e-60.
    IPB003510A    5-54
    IPB003510B    58-101


ProDom Summary:  Protein Domain Search
Residues 8-121 are 64% similar to a (HYDROPHOBIC REDUCTASE FUMARATE) protein domain (PD015900) which is seen in Q9CP58_PASMU.



Paralogs:  Local Blast Search


HD0033 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 128 (E-value = 1.6e-72) place HD0033 in the Fumarate_red_C family which is described as Fumarate reductase subunit C (PF02300)

PDB Hit:
pdb|1FUM|C Chain C, Structure Of The E. Coli Fumarate Reductase... 120 1e-028
pdb|1FUM|C Chain C, Structure Of The E. Coli Fumarate Reductase... 223 1e-059

Gene Protein Sequence:
MTTKRKAYVREMKANWWTKLDFYRMYMIREATCIATIWFCLVLLYGVISL
GGRHIENFISFSQNPLVVILNIISLAGLLYHAATLYVMTPQVLTIVVKNE
RLNPNILKNALWAITGLVSLLALVLVYI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACGAAACGCAAAGCATATGTACGAGAAATGAAAGCAAATTGGTG
GACTAAACTTGATTTCTACAGAATGTATATGATACGTGAAGCGACGTGTA
TTGCGACTATTTGGTTTTGTTTAGTCTTGCTTTATGGTGTGATTAGCCTT
GGTGGACGGCATATTGAAAACTTTATTAGTTTTTCACAAAACCCGCTCGT
GGTTATTTTAAATATTATCAGCTTGGCTGGATTGTTGTATCACGCAGCGA
CTTTATATGTAATGACGCCACAAGTGTTGACGATTGTGGTTAAAAACGAA
CGACTAAATCCAAATATCTTGAAAAATGCACTTTGGGCAATAACGGGTTT
AGTTAGCTTGCTTGCATTAGTTTTGGTTTATATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy