Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR24 IGR25 IGR23 IGR18 IGR27 IGR21 IGR19 IGR26 IGR20 IGR22 HD0020 HD0021 genX, - HD0029 dcuB, - HD0025 HD0035 frdD, - HD0034 crcB, - HD0024 frdC, - HD0033 frdB, - HD0032 dapF, - HD0026 HD0023 lysA, - HD0036 frdA, - HD0030 HD0020 HD0021 genX, - HD0029 dcuB, - HD0025 HD0035 frdD, - HD0034 crcB, - HD0024 frdC, - HD0033 frdB, - HD0032 dapF, - HD0026 HD0023 lysA, - HD0036 frdA, - HD0030 genX, - HD0029 dcuB, - HD0025 HD0022 HD0021 HD0020 HD0022 crcB, - HD0024 frdC, - HD0033 frdB, - HD0032 dapF, - HD0026 HD0023 lysA, - HD0036 frdA, - HD0030 frdD, - HD0034 HD0035
* Calculated from Protein Sequence

Gene ID: HD0029

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
genX  

Definition:
lysine--tRNA ligase, genX

Gene Start:
28234

Gene Stop:
27251

Gene Length:
984

Molecular Weight*:
37563

pI*:
5.50

Net Charge*:
-8.75

EC:
6.1.1.6  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Lysine biosynthesis

Secondary Evidence:
Kong,L., Fromant,M., Blanquet,S. and Plateau,P.
Evidence for a new Escherichia coli protein resembling a lysyl-tRNA synthetase.
Gene 108 (1), 163-164 (1991)
Medline: 92104501.

Cole,S.T.
Nucleotide sequence coding for the flavoprotein subunit of the fumarate reductase of Escherichia coli.
Eur. J. Biochem. 122 (3), 479-484 (1982)
Medline: 82138876.

Gampel,A. and Tzagoloff,A.
Homology of aspartyl- and lysyl-tRNA synthetases.
Proc. Natl. Acad. Sci. U.S.A. 86 (16), 6023-6027 (1989)
Medline: 89345597


Comment:
From GenBank (gi:135138): In E. coli, this protein could be a lysyl-tRNA synthetase. Mutants in PoxA have a reduced pyruvate oxidase activity and a reduced growth rate. Catalytic acitivity: ATP + L-lysine + tRNA(lys) = AMP + pyrophosphate + L-lysyl-tRNA(lys). Belongs to the Class-II aminoacyl-tRNA synthetase family.

Check start codon. No hits to the first 5 amino acid residues. Residue 6 is L.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to putative lysyl-tRNA synthetase proteins; e.g., residues 6-327 are 71% similar to SYK3_HAEIN [1174524], residues 6-327 are 71% similar to SYK3_HAEGA [8928399], and residues 11-327 are 65% similar to SYK3_SALTY [8928400].

COGS Summary:  COGS Search
BeTs to 11 clades of COG1190
COG name: Lysyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG1190 is ----YQvcEbRHujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002106 (Aminoacyl-transfer RNA synthetases class-II) with a combined E-value of 3.2e-06.
    IPB002106A    33-45
    IPB002106B    302-316


ProDom Summary:  Protein Domain Search
Residues 282-322 are 78% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000848) which is seen in SYK3_HAEGA.

Residues 238-281 are 63% similar to a (LIGASE SYNTHETASE AMINOACYL-TRNA) protein domain (PD383134) which is seen in SYK3_ECOLI.

Residues 146-256 are 38% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD110938) which is seen in SYK_CAMJE.

Residues 47-237 are 77% similar to a (SYNTHETASE LIGASE LYSYL-TRNA) protein domain (PD190229) which is seen in SYK3_HAEIN.

Residues 212-265 are 61% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE) protein domain (PD411766) which is seen in Q9F112_AGRTU.



Paralogs:  Local Blast Search


HD0029 is paralogously related to HD1318 (7e-41) and HD0599 (1e-06).


Pfam Summary:  Pfam Search
Residues 5 to 327 (E-value = 8.2e-118) place HD0029 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
pdb|1E1O|A Chain A, Lysyl-Trna Synthetase (Lysu) Hexagonal For,... 155 9e-039
pdb|1BBU|A Chain A, Lysyl-Trna Synthetase (Lyss) Complexed With... 143 3e-035

Gene Protein Sequence:
MSDASLTKINWQPTASIQTLLKRSKIMAEIRQFFTDRGVLEVETPALSEY
SVTDVHLSTFSTEFLSPFAKQAKTLHLITSPEYHMKRLLAAGSSSIFQLC
RVFRNEESGKRHNPEFTMLEWYRPHFDMYRLINEVDDLLQQILDCEPIES
YSYQFVFQTYVGLDPLSASRAQLVEKARKHGFACEEDENRDTLLQFLFSE
IVEANIGQERPTTVYHFPSSQAALAQISSEDHRVAERFEIYYKGLELANG
FHELNDAKEQIRRFERDNQLREQMNLPPQPLDMRFLAALKAGIPNCSGVA
LGVDRLIMLALNANHIQEVMAFGVERA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGACGCATCCTTAACAAAGATTAATTGGCAACCGACCGCCTCTAT
CCAGACATTATTAAAACGTAGCAAAATTATGGCAGAAATCCGTCAGTTTT
TTACTGACCGTGGTGTATTAGAAGTGGAAACGCCCGCTTTAAGTGAATAC
TCAGTCACTGATGTACATCTTTCTACTTTCAGTACCGAATTTCTCTCGCC
TTTTGCTAAACAAGCAAAAACCTTGCATTTGATAACCAGCCCTGAATACC
ACATGAAGCGCTTACTCGCGGCAGGAAGCAGTTCGATTTTCCAACTTTGT
CGCGTATTCCGCAACGAAGAATCAGGCAAACGCCATAATCCAGAATTTAC
CATGTTAGAATGGTATCGCCCCCATTTTGATATGTACCGCTTAATCAATG
AAGTAGATGACTTATTACAACAAATCTTAGATTGTGAGCCGATAGAATCC
TATAGCTATCAATTTGTATTCCAGACTTATGTCGGATTAGATCCACTGTC
CGCTAGCCGTGCACAATTAGTTGAAAAAGCCCGCAAACACGGCTTTGCTT
GTGAAGAAGATGAAAATCGCGATACCTTATTACAATTTTTATTTAGCGAG
ATTGTAGAAGCGAATATCGGCCAAGAACGCCCCACAACCGTCTATCATTT
CCCATCATCACAAGCGGCATTAGCACAGATTAGCTCAGAAGATCATCGCG
TGGCTGAGCGGTTTGAAATCTACTATAAAGGATTAGAGCTAGCAAATGGC
TTCCATGAATTAAATGATGCCAAAGAACAAATACGCCGTTTTGAACGAGA
TAATCAATTACGCGAACAGATGAATTTGCCACCACAACCATTAGATATGC
GTTTTCTAGCCGCCTTAAAAGCAGGCATACCAAATTGCTCTGGAGTAGCA
CTAGGTGTCGATCGTTTAATTATGCTTGCCCTCAACGCAAACCATATCCA
AGAAGTAATGGCATTTGGTGTTGAAAGAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy