Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR16 IGR17 IGR18 IGR13 IGR15 IGR14 IGR21 IGR19 IGR20 IGR22 HD0020 HD0018 HD0021 HD0019 yfeU, - HD0017 genX, - HD0029 dcuB, - HD0025 crcB, - HD0024 dapF, - HD0026 prmA, - HD0016 HD0023 tldD, - HD0015 frdA, - HD0030 HD0020 HD0018 HD0021 HD0019 yfeU, - HD0017 genX, - HD0029 dcuB, - HD0025 crcB, - HD0024 dapF, - HD0026 prmA, - HD0016 HD0023 tldD, - HD0015 frdA, - HD0030 HD0019 yfeU, - HD0017 genX, - HD0029 dcuB, - HD0025 HD0022 HD0021 HD0018 HD0020 HD0022 crcB, - HD0024 dapF, - HD0026 prmA, - HD0016 HD0023 tldD, - HD0015 frdA, - HD0030
* Calculated from Protein Sequence

Gene ID: HD0023

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
permease

Gene Start:
23295

Gene Stop:
24359

Gene Length:
1065

Molecular Weight*:
39911

pI*:
9.80

Net Charge*:
11.10

EC:
 

Functional Class:
Unassigned  

Pathway: pathway table

Comment:
Subthreshold hits is gapped BLAST and hits to COGS suggest that this protein may be a permease.

Blast Summary:  PSI-Blast Search
Single match in gapped BLAST to 24324225 for permeases of the major facilitator superfamily from Wigglesworthia brevipalpis: residues 8-307 are 20% similar to this protein.

Otherwise, no significant hits in gapped BLAST. Several subthreshold hits in gapped BLAST to putative transport system permease proteins; e.g., residues 3-147 are 26% similar to a putative transport system permease protein in Streptomyces coelicolor [7481629], and residues 3-282 are 21% similar to a probable integral membrane transport protein in Mycobacterium tuberculosis [7478160].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0477
COG name: Permeases
Functional Class: G,E,R
The phylogenetic pattern of COG0477 is AMTKYQVCEBRHUJGPo-INX
Number of proteins in this genome belonging to this COG is 12

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0023 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MHLQRLLLIRRFFSTLAFFSMQTVFFIYLQKKGLSNAEIAFSLSLLFFCN
QALAILAGIWGDRYGLAKMMLLGCLLDVCAYAFFLSADHYAILLLATVCF
GLGSCLFSTNAKACLLALAGEEYAEKTRLQGKYLQVTSMSSMVAPLLVIP
FIKFDQIALLIWVCFAIEASLFVLMVKPFYQIQTAQTLVKFRFGQIKQIL
TKEFLFVHLMLFIPLSIATSFFVIFPFLFDNKLAMPEHSPIALFVNGLLT
VLLQSYFSRKINLNAKQTVWVAPILAAAMIVPWFITLHYISLFSAYLYLV
IFTVVEVYALTAMANLLVKFDNGVNRGFIFGASRLLLSIATVIVMNLIPH
LFLV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACCTTCAAAGACTTTTACTTATTCGTCGTTTTTTTTCGACATTAGC
ATTTTTTTCAATGCAAACGGTTTTTTTTATTTATCTACAAAAGAAAGGCT
TGAGTAATGCTGAGATTGCGTTTTCGCTCTCTTTGTTGTTTTTTTGTAAT
CAAGCATTAGCCATTTTAGCGGGCATTTGGGGCGATCGGTATGGTTTAGC
CAAGATGATGTTGTTAGGCTGTTTGCTTGATGTTTGTGCGTACGCTTTCT
TTTTGTCCGCCGATCATTACGCCATATTGCTGTTAGCAACAGTCTGTTTT
GGTTTGGGCAGTTGTTTATTTAGCACGAATGCTAAGGCTTGTTTGTTGGC
ATTAGCCGGGGAAGAATATGCCGAGAAGACTAGGCTACAAGGCAAATATT
TGCAAGTGACTTCAATGTCTTCAATGGTGGCCCCTTTGTTGGTTATTCCA
TTTATTAAGTTTGACCAAATTGCGTTGTTAATTTGGGTCTGCTTTGCGAT
TGAAGCGAGCTTATTTGTTTTGATGGTGAAGCCGTTTTATCAGATTCAAA
CAGCACAAACATTGGTTAAATTCCGTTTTGGGCAAATTAAGCAGATTCTT
ACCAAAGAGTTTTTATTTGTGCATTTAATGTTGTTTATTCCGCTATCAAT
TGCGACTTCTTTTTTTGTGATTTTTCCATTTTTATTTGATAATAAATTAG
CTATGCCAGAGCATAGTCCAATCGCATTGTTTGTGAATGGTTTGCTGACA
GTGTTATTACAGAGTTATTTTTCGCGAAAAATCAATTTAAACGCTAAACA
AACGGTATGGGTTGCGCCGATCTTAGCCGCAGCAATGATTGTGCCGTGGT
TTATTACATTGCATTATATTTCGTTATTTTCAGCTTATCTGTATTTAGTT
ATATTTACGGTGGTAGAGGTATATGCGTTAACGGCAATGGCGAATTTATT
AGTAAAATTTGATAACGGCGTAAATCGCGGCTTTATTTTTGGCGCATCTC
GGCTATTGTTATCAATTGCGACAGTAATTGTGATGAATTTAATTCCGCAT
TTATTTTTGGTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy