Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-1 tRNA-Asp-1 rRNA-5S-1 IGR16 IGR17 IGR18 IGR13 IGR15 IGR14 IGR19 IGR12 IGR11 HD0020 HD0018 HD0021 HD0019 yfeU, - HD0017 mesJ, - HD0014 dcuB, - HD0025 crcB, - HD0024 prmA, - HD0016 xerD, - HD0013 HD0023 tldD, - HD0015 HD0020 HD0018 HD0021 HD0019 yfeU, - HD0017 mesJ, - HD0014 dcuB, - HD0025 crcB, - HD0024 prmA, - HD0016 xerD, - HD0013 HD0023 tldD, - HD0015 HD0019 yfeU, - HD0017 mesJ, - HD0014 dcuB, - HD0025 HD0022 HD0021 HD0018 HD0020 HD0022 crcB, - HD0024 prmA, - HD0016 xerD, - HD0013 HD0023 tldD, - HD0015
* Calculated from Protein Sequence

Gene ID: HD0016

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
prmA  

Definition:
ribosomal protein L11 methyltransferase, prmA

Gene Start:
20276

Gene Stop:
21157

Gene Length:
882

Molecular Weight*:
31947

pI*:
4.30

Net Charge*:
-17.50

EC:
2.1.1.-  

Functional Class:
Translation; Ribosomal proteins: synthesis and modification  

Pathway: pathway table
Aminophosphonate metabolism
Androgen and estrogen metabolism
Histidine metabolism
Porphyrin and chlorophyll metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis

Secondary Evidence:
Vanet,A., Plumbridge,J.A. and Alix,J.H.
Cotranscription of two genes necessary for ribosomal protein L11 methylation (prmA) and pantothenate transport (panF) in Escherichia coli K-12. J. Bacteriol. 175 (22), 7178-7188 (1993)
Medline: 94042890.

Vanet,A., Plumbridge,J.A., Guerin,M.F. and Alix,J.H.
Ribosomal protein methylation in Escherichia coli: the gene prmA, encoding the ribosomal protein L11 methyltransferase, is dispensable.
Mol. Microbiol. 14 (5), 947-958 (1994)
Medline: 95231301


Comment:
From GenBank (gi:1172623): In H. influenzae, this protein methylates 50S ribosomal protein L11.

Note: Check start codon. Hits in gapped BLAST started at residue 12, a methionine; there were no hits to the first 11 residues of this protein. Residue 1 is currently not a methionine.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ribosomal protein L11 methyltransferases; e.g., residues 12-303 are 75% similar to PRMA_ECOLI [464465], residues 12-301 are 75% similar to PRMA_HAEIN [1172623], and residues 12-303 are 68% similar to the sequence for ribosomal protein L11 methyltransferase in Vibrio cholerae [9654704].

COGS Summary:  COGS Search
BeTs to 6 clades of COG2264
COG name: Ribosomal protein L11 methylase
Functional Class: J
The phylogenetic pattern of COG2264 is AMTK-QVCE-rH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 90-149 are 91% similar to a (METHYLTRANSFERASE RIBOSOMAL COMPLETE) protein domain (PD009497) which is seen in Q9CLW2_PASMU.

Residues 213-290 are 74% similar to a (METHYLTRANSFERASE RIBOSOMAL L11 COMPLETE) protein domain (PD268834) which is seen in Q9CLW2_PASMU.

Residues 156-208 are 81% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD015912) which is seen in PRMA_HAEIN.

Residues 1-65 are 87% similar to a (METHYLTRANSFERASE L11 RIBOSOMAL COMPLETE) protein domain (PD033741) which is seen in PRMA_HAEIN.

Residues 162-206 are 80% similar to a (METHYLTRANSFERASE COMPLETE PROTEOME ARGININE) protein domain (PD006760) which is seen in Q9KV64_VIBCH.



Paralogs:  Local Blast Search

HD0016 is paralogously related to HD1750 (2e-04) and HD1050 (7e-04).


Pfam Summary:  Pfam Search
Residues 2 to 293 (E-value = 2.7e-160) place HD0016 in the PrmA family which is described as Ribosomal protein L11 methyltransferase (PrmA) (PF06325)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAWLQIRLNSTDKYAEQISDFLEEIGAVSVTFMDSQDTPIFEPLPGETRL
WGNTDVMGLFDAETDMQAVVSALITSGLVTADFAHKVEQIEDKDWEREWM
DNFHPMQFGQRLWICPSWREVPDEKAVNIMLDPGLAFGTGTHPTTALCLQ
WLDGLDLTGKTVIDFGCGSGILAISALKLGAKQAIGIDIDPQAILASQNN
AAANGVADRLQLFLAKDQPQALQADVVVANILAGPLKELAPNIMTLVKPQ
GYLGLSGILATQAQSVCQAYAAVFKLDPVVEKEEWCRITGIKQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGTGGCTACAAATTCGTTTAAATAGTACAGATAAATATGCTGAACA
AATCAGTGATTTTTTAGAAGAAATAGGTGCAGTATCAGTTACCTTTATGG
ATAGTCAAGATACTCCGATTTTTGAACCGCTACCCGGTGAAACACGCCTA
TGGGGTAACACGGATGTAATGGGCTTATTTGATGCAGAAACAGATATGCA
AGCCGTTGTTAGTGCGTTAATTACTAGCGGTCTTGTTACGGCTGATTTTG
CCCATAAGGTTGAACAAATTGAAGATAAAGATTGGGAACGGGAATGGATG
GATAACTTCCATCCGATGCAATTTGGTCAACGTTTGTGGATTTGTCCAAG
TTGGCGTGAGGTGCCAGATGAAAAAGCGGTAAATATAATGTTAGATCCTG
GTTTAGCATTTGGTACAGGCACGCATCCGACTACAGCCCTTTGCTTGCAG
TGGTTAGATGGTTTGGATTTAACGGGCAAAACCGTGATTGATTTTGGTTG
TGGTTCAGGTATTTTAGCCATTTCTGCCCTTAAATTAGGCGCTAAACAAG
CGATCGGGATCGATATTGATCCGCAAGCGATACTAGCGTCGCAAAATAAT
GCGGCAGCTAACGGTGTAGCGGATCGTTTACAACTATTTTTAGCGAAAGA
TCAACCGCAAGCTTTACAAGCAGATGTCGTAGTGGCAAATATTTTAGCTG
GCCCGTTAAAAGAACTTGCTCCTAATATTATGACGTTAGTTAAGCCTCAA
GGCTATTTAGGCCTGTCTGGTATTTTAGCGACTCAAGCACAATCAGTTTG
CCAAGCATATGCGGCAGTATTTAAGTTGGATCCAGTGGTTGAAAAGGAAG
AGTGGTGTCGTATTACTGGCATTAAGCAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy