Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-1 tRNA-Ile-1 rRNA-16S-1 rRNA-23S-1 IGR7 IGR6 IGR9 IGR8 IGR10 IGR11 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008
* Calculated from Protein Sequence

Gene ID: HD0011

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
atpC  

Definition:
ATP synthase F1, subunit epsilon

Gene Start:
9736

Gene Stop:
10155

Gene Length:
420

Molecular Weight*:
15390

pI*:
9.70

Net Charge*:
2.24

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Nielsen,J., Hansen,F.G., Hoppe,J., Friedl,P. and von Meyenburg,K. The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli.
Mol. Gen. Genet. 184 (1), 33-39 (1981)
Medline: 82147764.

Kanazawa,H., Mabuchi,K., Kayano,T., Noumi,T., Sekiya,T. and Futai,M.
Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits.
Biochem. Biophys. Res. Commun. 103 (2), 613-620 (1981)
Medline: 82134799.

Cain,B.D. and Simoni,R.D.
Impaired proton conductivity resulting from mutations in the a subunit of F1F0 ATPase in Escherichia coli.
J. Biol. Chem. 261 (22), 10043-10050 (1986)
Medline: 86278048.

Kumamoto,C.A. and Simoni,R.D.
Genetic evidence for interaction between the a and b subunits of the F0 portion of the Escherichia coli proton translocating ATPase.
J. Biol. Chem. 261 (22), 10037-10042 (1986)
Medline: 86278047.

Cain,B.D. and Simoni,R.D.
Proton translocation by the F1F0ATPase of Escherichia coli. Mutagenic analysis of the a subunit.
J. Biol. Chem. 264 (6), 3292-3300 (1989)
Medline: 89123453.

Yamada,H., Moriyama,Y., Maeda,M. and Futai,M.
Transmembrane topology of Escherichia coli H(+)-ATPase (ATP synthase) subunit a.
FEBS Lett. 390 (1), 34-38 (1996)
Medline: 96314544.

Valiyaveetil,F.I. and Fillingame,R.H.
Transmembrane topography of subunit a in the Escherichia coli F1F0 ATP synthase.
J. Biol. Chem. 273 (26), 16241-16247 (1998)
Medline: 98298136.

Hausrath,A.C., Gruber,G., Matthews,B.W. and Capaldi,R.A. Structural features of the gamma subunit of the Escherichia coli F(1) ATPase revealed by a 4.4-A resolution map obtained by x-ray crystallography.
Proceedings of the National Academy of Sciences of the United States of America. 96 (24), 13697-13702 (1999)
Medline: 20040613


Comment:
From GenBank (gi:114596): AtpE produces ATP from ADP in the presence of a proton gradient across the membrane. F-type ATPases have two components, CF(1), the catalytic core, and CF(0), the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), and EPSILON(1). CF(0) has three main subunits: A, B and C.

See also other chains of the F1 subunit: atpD (delta chain), HD0007; atpB (beta chain), HD0010; atpD (delta chain), HD0008; atpG (gamma chain), HD0009.

In addition, see chains of the F0 subunit of this ATPase: atpF (B chain), HD0006; and atp6 (A chain), HD0004; and atpL (C chain), HD0005.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ATP synthase F1 sector epsilon subunit proteins. Residues 3-139 are 58% similar to 20137463, an ATP synthase epsilon chain [Pasteurella multocida]. Residues 5-139 are 58% similar to 16272425, an ATP synthase F1, subunit epsilon (atpC) [Haemophilus influenzae].

COGS Summary:  COGS Search
BeTs to 10 clades of COG0355
COG name: FoF1-type ATP synthase epsilon subunit
Functional Class: C
The phylogenetic pattern of COG0355 is ----yqvcebrhuj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001469 (ATP synthase, Delta/Epsilon chain) with a combined E-value of 2.1e-27.
    IPB001469A    16-53
    IPB001469B    65-85


ProDom Summary:  Protein Domain Search
Residues 5-82 are 69% similar to a (SYNTHASE EPSILON CHAIN ION HYDROLASE CF1 SYNTHESIS) protein domain (PD000944) which is seen in Q9CKW0_PASMU.



Paralogs:  Local Blast Search

HD0011 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 86 (E-value = 1.4e-26) place HD0011 in the ATP-synt_DE_N family which is described as ATP synthase, Delta/Epsilon chain, beta-sandwich domain (PF02823)

PDB Hit:
pdb|1AQT| Epsilon Subunit Of F1f0-Atp Synthase From Escheric... 130 7e-032
pdb|1BSH|A Chain A, Solution Structure Of The Epsilon Subunit O... 130 9e-032

Gene Protein Sequence:
MASQFELRIVSAEKQIFNGQVVSVRVSGVEGELGIYAGHTPLLTAIKPGM
VKYTLEDNKEEFIYVSGGFLEVQPTIVTVLADIAIRGEELDQQRIIAAKR
KAEDTLSKTNNAELSAKLAREIAKLRVYEIVNSKLTKKR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCATCTCAATTTGAACTTAGAATAGTAAGTGCGGAAAAACAAATCTT
TAATGGTCAAGTGGTTAGCGTACGTGTAAGTGGTGTTGAAGGTGAATTAG
GTATTTATGCTGGACATACACCCTTATTAACAGCAATAAAACCAGGTATG
GTTAAATATACCCTTGAAGATAATAAAGAAGAGTTTATTTATGTATCAGG
TGGTTTCTTAGAAGTACAACCTACAATCGTAACTGTTCTTGCTGATATTG
CAATTCGTGGTGAAGAATTAGATCAACAACGTATTATTGCTGCAAAACGT
AAAGCTGAAGATACGCTTAGTAAAACAAACAATGCGGAATTATCAGCTAA
ACTTGCTCGTGAAATTGCAAAACTACGTGTTTACGAAATTGTAAATTCAA
AATTAACTAAAAAACGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy