Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR7 IGR6 IGR9 IGR8 IGR3 IGR10 IGR5 IGR1.1 IGR4 IGR1 IGR2 atpE, - HD0005 HD0003 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpC, - HD0011 atpF, - HD0006 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD0006

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
atpF  

Definition:
ATP synthase F0, subunit b

Gene Start:
4846

Gene Stop:
5316

Gene Length:
471

Molecular Weight*:
17299

pI*:
5.10

Net Charge*:
-3.80

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Nielsen,J., Hansen,F.G., Hoppe,J., Friedl,P. and von Meyenburg,K. The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli.
Mol. Gen. Genet. 184 (1), 33-39 (1981)
Medline: 82147764.

Kanazawa,H., Mabuchi,K., Kayano,T., Noumi,T., Sekiya,T. and Futai,M.
Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits.
Biochem. Biophys. Res. Commun. 103 (2), 613-620 (1981)
Medline: 82134799.

Cain,B.D. and Simoni,R.D.
Impaired proton conductivity resulting from mutations in the a subunit of F1F0 ATPase in Escherichia coli.
J. Biol. Chem. 261 (22), 10043-10050 (1986)
Medline: 86278048.

Kumamoto,C.A. and Simoni,R.D.
Genetic evidence for interaction between the a and b subunits of the F0 portion of the Escherichia coli proton translocating ATPase.
J. Biol. Chem. 261 (22), 10037-10042 (1986)
Medline: 86278047.

Cain,B.D. and Simoni,R.D.
Proton translocation by the F1F0ATPase of Escherichia coli. Mutagenic analysis of the a subunit.
J. Biol. Chem. 264 (6), 3292-3300 (1989)
Medline: 89123453.

Yamada,H., Moriyama,Y., Maeda,M. and Futai,M.
Transmembrane topology of Escherichia coli H(+)-ATPase (ATP synthase) subunit a.
FEBS Lett. 390 (1), 34-38 (1996)
Medline: 96314544.

Valiyaveetil,F.I. and Fillingame,R.H.
Transmembrane topography of subunit a in the Escherichia coli F1F0 ATP synthase.
J. Biol. Chem. 273 (26), 16241-16247 (1998)
Medline: 98298136.

Comment:
See also chains of the F1 subunit: atpA (alpha chain), HD0008; atpB (beta chain), HD0010; atpG (gamma chain), HD0009; atpD (delta chain), HD0007; atpE (epsilon chain), HD0011.

In addition, see the other chains of the F0 subunit of this ATPase: atpL (C chain), HD0005, and atp6 (A chain), HD0004.

Note: This non-Methionine start is supported by the BLAST results.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to atpF proteins; e.g. residues 1-156 are 67% similar to ATPF_HAEIN; residues 1-156 are 55% similar to ATPF_ECOLI; and residues 1-156 are 55% similar to those in ATP synthase subunit b in Salmonella typhimurium.



COGS Summary:  COGS Search
BeTs to 8 clades of COG0711
COG name: FoF1-type ATP synthase B subunit
Functional Class: C
The phylogenetic pattern of COG0711 is -----QvCebRhujgp----x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002146 (ATP synthase B/B' CF(0)) with a combined E-value of 2e-18.
    IPB002146    11-49


ProDom Summary:  Protein Domain Search
Residues 30-127 are 59% similar to a (B SYNTHASE CHAIN SUBUNIT) protein domain (PD201732) which is seen in Q9CKW4_PASMU.



Paralogs:  Local Blast Search
HD0006 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 137 (E-value = 2.3e-37) place HD0006 in the ATP-synt_B family which is described as ATP synthase B/B' CF(0) (PF00430)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VNLNATLIGQLIAFALFVAFCMKYVWPPLIKAIEERQANIANALSSAEKA
KQEQADSKVLAEQEIIKAKEEAQKIIDLATKRRNEILESVQADAEVERQR
IIEQGHAEIDSERKRVQEELRQKVAALAVAGAERIVGRSVDTAANNDIID
KLVAEL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATTTAAATGCAACACTAATTGGTCAACTTATTGCATTCGCACTATT
TGTTGCGTTTTGTATGAAATATGTATGGCCACCGCTTATTAAAGCGATCG
AAGAGCGTCAAGCAAATATTGCGAATGCTTTATCATCTGCTGAAAAAGCG
AAGCAAGAACAAGCTGATTCTAAAGTTTTAGCTGAGCAAGAAATCATTAA
AGCAAAAGAAGAAGCACAAAAAATTATTGATTTAGCAACAAAACGTCGTA
ATGAAATTTTAGAGTCTGTACAAGCAGATGCTGAAGTTGAGCGCCAACGT
ATCATTGAACAAGGCCACGCGGAAATAGATAGTGAGCGTAAGCGTGTTCA
AGAAGAGCTTCGTCAAAAAGTGGCAGCATTAGCTGTAGCTGGAGCAGAAA
GAATTGTTGGCCGCTCAGTAGATACTGCAGCAAATAATGACATTATAGAT
AAACTCGTTGCAGAGTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy