Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR7 IGR6 IGR9 IGR8 IGR3 IGR5 IGR1.1 IGR4 IGR1 IGR2 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpF, - HD0006 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD0005

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
atpE  

Definition:
ATP synthase F0, subunit c

Gene Start:
4538

Gene Stop:
4792

Gene Length:
255

Molecular Weight*:
8698

pI*:
4.80

Net Charge*:
-1.02

EC:
3.6.3.14  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
ATP synthesis
Flagellar assembly
Photosynthesis
Type III secretion system

Primary Evidence:
NULL

Secondary Evidence:
Nielsen,J., Hansen,F.G., Hoppe,J., Friedl,P. and von Meyenburg,K. The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli.
Mol. Gen. Genet. 184 (1), 33-39 (1981)
Medline: 82147764.

Kanazawa,H., Mabuchi,K., Kayano,T., Noumi,T., Sekiya,T. and Futai,M.
Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits.
Biochem. Biophys. Res. Commun. 103 (2), 613-620 (1981)
Medline: 82134799.

Cain,B.D. and Simoni,R.D.
Impaired proton conductivity resulting from mutations in the a subunit of F1F0 ATPase in Escherichia coli.
J. Biol. Chem. 261 (22), 10043-10050 (1986)
Medline: 86278048.

Kumamoto,C.A. and Simoni,R.D.
Genetic evidence for interaction between the a and b subunits of the F0 portion of the Escherichia coli proton translocating ATPase.
J. Biol. Chem. 261 (22), 10037-10042 (1986)
Medline: 86278047.

Cain,B.D. and Simoni,R.D. Proton translocation by the F1F0ATPase of Escherichia coli. Mutagenic analysis of the a subunit. J. Biol. Chem. 264 (6), 3292-3300 (1989)
Medline: 89123453.

Yamada,H., Moriyama,Y., Maeda,M. and Futai,M. Transmembrane topology of Escherichia coli H(+)-ATPase (ATP synthase) subunit a. FEBS Lett. 390 (1), 34-38 (1996)
Medline: 96314544.

Valiyaveetil,F.I. and Fillingame,R.H.
Transmembrane topography of subunit a in the Escherichia coli F1F0 ATP synthase.
J. Biol. Chem. 273 (26), 16241-16247 (1998)
Medline: 98298136.

Comment:
The N-terminal half of this short protein matched only weakly to the N-terminal half of a few ATPase proteins in GenBank. The C-terminal half was comparatively well-conserved.

See also chains of the F1 subunit: atpA (alpha chain), HD0008; atpB (beta chain), HD0010; atpG (gamma chain), HD0009; atpD (delta chain), HD0007; atpE (epsilon chain), HD0011.

In addition, see the other chains of the F0 subunit of this ATPase: atpF (B chain), HD0006, and atp6 (A chain), HD0004.

Note: Check the start codon. Hits started at residue 12, a methionine.

Blast Summary:  PSI-Blast Search
Many significant matches in gapped BLAST to ATP synthase, subunit c proteins: H. influenzae (16272431, 1168602), Pseudomonas aeruginosa PA01 (15600752), and Vibrio cholerae (15642762), among others.



COGS Summary:  COGS Search
BeTs to 7 clades of COG0636
COG name: FoF1-type ATP synthase c subunit/Vacuolar ATPase/archaeal ATP synthase K subunit
Functional Class: C
The phylogenetic pattern of COG0636 is AmtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000454 (Eubacterial and plasma membrane ATP synthase subunit C) with a combined E-value of 4e-17.
    IPB000454    15-68


ProDom Summary:  Protein Domain Search
Residues 35-75 are 97% similar to a (LIPID-BINDING C SYNTHASE CHAIN) protein domain (PD186061) which is seen in ATPL_HAEIN.

Residues 33-79 are 63% similar to a (C LIPID-BINDING ION SUBUNIT) protein domain (PD390276) which is seen in Q9JR78_NEIMB.



Paralogs:  Local Blast Search
HD0005 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 76 (E-value = 1.9e-24) place HD0005 in the ATP-synt_C family which is described as ATP synthase subunit C (PF00137)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MESVITATIIGASLLLAFAALGTAIGFAILGGKFLESSSRQPELASSLQT
KMFIVAGLLDAIAMIAVGISLLFIFANPFIDLLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAATCAGTAATCACAGCAACAATTATTGGTGCGTCACTATTATTAGC
TTTTGCTGCACTTGGTACAGCGATTGGTTTTGCTATCTTAGGTGGTAAAT
TCTTAGAATCATCATCTCGTCAACCTGAATTAGCTAGTAGTTTACAAACT
AAAATGTTTATCGTTGCAGGTCTTTTAGATGCTATCGCAATGATCGCTGT
TGGTATTTCTTTACTTTTCATCTTCGCGAACCCATTCATTGATTTATTGA
AATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy