Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR7 IGR6 IGR9 IGR8 IGR3 IGR5 IGR1.1 IGR4 IGR1 IGR2 IGR1499 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpD, - HD0010 atpA, - HD0008 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD0004

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
atpA  

Definition:
ATP synthase F0, subunit a

Gene Start:
3629

Gene Stop:
4417

Gene Length:
789

Molecular Weight*:
29221

pI*:
6.90

Net Charge*:
-0.51

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Oxidative phosphorylation

Secondary Evidence:
Nielsen,J., Hansen,F.G., Hoppe,J., Friedl,P. and von Meyenburg,K.
The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli.
Mol. Gen. Genet. 184 (1), 33-39 (1981)
Medline: 82147764.

Kanazawa,H., Mabuchi,K., Kayano,T., Noumi,T., Sekiya,T. and Futai,M.
Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits.
Biochem. Biophys. Res. Commun. 103 (2), 613-620 (1981)
Medline: 82134799.

Cain,B.D. and Simoni,R.D.
Impaired proton conductivity resulting from mutations in the a subunit of F1F0 ATPase in Escherichia coli.
J. Biol. Chem. 261 (22), 10043-10050 (1986)
Medline: 86278048.

Kumamoto,C.A. and Simoni,R.D.
Genetic evidence for interaction between the a and b subunits of the F0 portion of the Escherichia coli proton translocating ATPase.
J. Biol. Chem. 261 (22), 10037-10042 (1986)
Medline: 86278047.

Cain,B.D. and Simoni,R.D.
Proton translocation by the F1F0ATPase of Escherichia coli. Mutagenic analysis of the a subunit.
J. Biol. Chem. 264 (6), 3292-3300 (1989)
Medline: 89123453.

Yamada,H., Moriyama,Y., Maeda,M. and Futai,M.
Transmembrane topology of Escherichia coli H(+)-ATPase (ATP synthase) subunit a.
FEBS Lett. 390 (1), 34-38 (1996)
Medline: 96314544.

Valiyaveetil,F.I. and Fillingame,R.H.
Transmembrane topography of subunit a in the Escherichia coli F1F0 ATP synthase.
J. Biol. Chem. 273 (26), 16241-16247 (1998)
Medline: 98298136.

Comment:
From GenBank (gi:1168558): AtpB is a key component of the proton
channel and may play a direct role in the translocation of protons
across the membrane. F-type ATPases have two components, CF(1), the catalytic core, and CF(0), the membrane proton channel. CF(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), and epsilon(1). CF(0) has three main subunits: a, b and c.

See also: atpA (alpha chain of F1), HD0008; atpB (beta chain of F1), HD0010; atpG (gamma chain of F1), HD0009; atpD (delta chain of F1), HD0007; atpE (epsilon chain of F1), HD0011.

In addition, see the other chains of the F0 subunit of this ATPase: atpF (B chain of F0), HD0006, and atpL (lipid-binding C chain of F0), HD0005.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to atp6 proteins; e.g. residues 5-262 are 86% similar to ATP6_HAEIN; residues 2-262 are 57% similar to ATP6_VIBAL; and residues 7-256 are 56% similar to ATP6_ECOLI. Also sigificant similarity to other bacterial and eukaryotic ATP6 sequences.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0356
COG name: FoF1-type ATP synthase a subunit
Functional Class: C
The phylogenetic pattern of COG0356 is -----qvcebrhujgp----x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000568 (ATP synthase A subunit) with a combined E-value of 2e-34.
    IPB000568A    91-112
    IPB000568B    173-208
    IPB000568C    233-253


ProDom Summary:  Protein Domain Search
Residues 106-169 are 89% similar to a (CHAIN SYNTHASE CF0 HYDROGEN) protein domain (PD374770) which is seen in ATP6_HAEIN.

Residues 175-254 are 91% similar to a (SYNTHASE CHAIN TRANSMEMBRANE ION) protein domain (PD010746) which is seen in ATP6_HAEIN.

Residues 30-105 are 78% similar to a (SYNTHASE CHAIN CF0 TRANSPORT) protein domain (PD002001) which is seen in ATP6_HAEIN.



Paralogs:  Local Blast Search
HD0004 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 82 to 255 (E-value = 4.3e-65) place HD0004 in the ATP-synt_A family which is described as ATP synthase A chain (PF00119)

PDB Hit:
pdb|1C17|M Chain M, A1c12 Subcomplex Of F1fo Atp Synthase 319 2e-088

Gene Protein Sequence:
MAVNTAEYIGHHLSFLSSGDGFWAVHLDTLFFSLVAGVLFLVVFSRVAKN
ATTGVPGKLQCLVEMVVEWVDGLVKDNFHGPRHMIAPLALTIFCWVFIMN
AIDLVPVDFLPQLANMFGIHYLRAVPTADISATLGMSICVFGLILFYTVK
SKGFNGLAKEYTLHPFNHWAFIPVNFILETVTLLAKPISLAFRLFGNMYA
GELIFILIAVMYMADNFALQALGIPLHLVWAIFHILVITLQAFIFMMLTI
VYLSIAYNKADH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTAAATACGGCAGAATATATCGGTCACCACTTAAGCTTTTTGTC
CTCTGGCGATGGCTTTTGGGCTGTTCATTTAGATACACTTTTCTTTTCGC
TTGTTGCAGGTGTGCTTTTTTTAGTTGTATTTTCGCGCGTTGCGAAAAAT
GCAACCACTGGCGTACCGGGTAAACTGCAATGTTTAGTGGAAATGGTGGT
TGAATGGGTTGATGGATTAGTAAAAGATAATTTCCACGGACCACGTCATA
TGATTGCACCATTAGCACTCACAATTTTTTGCTGGGTCTTTATTATGAAT
GCGATTGACTTAGTCCCGGTCGATTTCTTGCCACAATTAGCAAATATGTT
TGGTATTCATTACCTGCGTGCCGTACCAACTGCCGATATTAGTGCCACTT
TAGGTATGTCTATTTGTGTATTTGGTTTAATTTTGTTCTATACTGTAAAA
TCTAAAGGTTTTAATGGTTTAGCAAAAGAATACACTCTTCACCCCTTTAA
TCATTGGGCGTTTATTCCCGTCAATTTTATTCTTGAAACAGTAACATTAC
TTGCAAAACCAATCTCTTTAGCATTCCGTTTATTCGGAAATATGTATGCA
GGTGAGTTAATTTTTATCCTTATTGCAGTTATGTATATGGCTGATAACTT
TGCACTTCAAGCATTAGGTATCCCATTGCATTTAGTTTGGGCTATTTTTC
ACATATTAGTGATCACTCTACAAGCCTTTATTTTTATGATGCTAACGATT
GTTTACTTGAGTATCGCTTATAATAAAGCAGATCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy