Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR7 IGR6 IGR8 IGR3 IGR5 IGR1498 IGR1.1 IGR4 IGR1 IGR2 IGR1499 yckJ, - HD2033 yckK, - HD2035 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpA, - HD0008 gidA, - HD0001 yckJ, - HD2033 yckK, - HD2035 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpA, - HD0008 gidA, - HD0001 yckK, - HD2035 HD2034 yckJ, - HD2033 HD2034 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpG, - HD0009 atpA, - HD0008 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD0002

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gidB  

Definition:
glucose inhibited division protein B

Gene Start:
2293

Gene Stop:
2904

Gene Length:
612

Molecular Weight*:
22796

pI*:
9.60

Net Charge*:
4.15

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Walker,J.E., Gay,N.J., Saraste,M. and Eberle,A.N.
DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS.
The Biochemical journal. 224 (3), 799-815 (1984).
Medline: 85121806.


Romanowski MJ, Bonanno JB, Burley SK.
Crystal structure of the Escherichia coli glucose-inhibited division protein B (GidB) reveals a methyltransferase fold.
Proteins. 2002 Jun 1;47(4):563-7. No abstract available.
PMID: 12001236

Comment:
From GenBank (gi:12518597): The function of this protein may be macromolecule synthesis. It may be involved in modification of DNA - replication, repair, restriction/modification. It is a glucose-inhibited division protein and is possibly involved in chromosome replication. See also GidA, HD0001.

From GenBank (gi:1169897): This protein is a probable S-adenosyl-L-methionine dependent methyltransferase specific for a sterol and/or lipid substrate.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glucose inhibited division protein B; e.g. residues 1-201 are 63% similar to
13431543 of Pasteurella multocida, residues 1-203 are 60% similar to 11354975 of Vibrio cholerae, residues 1-201 are 58% similar to 121191 of Escherichia coli.

Residues 1-201 are 66% similar to GidB of H.influenzae (1169897).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0357
COG name: Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division
Functional Class: M
The phylogenetic pattern of COG0357 is -----qvcebrhujgpol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003682 (Glucose inhibited division protein) with a combined E-value of 2.2e-50.
    IPB003682A    31-58
    IPB003682B    71-96
    IPB003682C    132-172


ProDom Summary:  Protein Domain Search
Residues 24-172 are 73% similar to a (DIVISION INHIBITED GLUCOSE PROTEOME) protein domain (PD004441) which is seen in GIDB_HAEIN.



Paralogs:  Local Blast Search
HD0002 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 20 to 199 (E-value = 1.8e-74) place HD0002 in the GidB family which is described as Glucose inhibited division protein (PF02527)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKQKLDRLLVQADIQLTERQKEQLIGFVHLLHKWNKAYNLTSVRDPEEML
VKHIMDSLVVSVHLQGQSFIDVGTGPGLPGIPLAIANPDKQFVLLDSLGK
RITFIKQVLRELAITNVTPVLSRVEQYTARQFDGVLSRAFASLDDMLNWC
YALPNDSGKFYALKGVYDGTELQAVQKPIKLVDAIKLNVPQLVGERHLIV
LAK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAAAAATTAGACCGATTACTTGTGCAGGCAGATATTCAGTTAAC
TGAACGGCAAAAAGAACAACTTATTGGCTTTGTTCATTTATTGCATAAAT
GGAATAAGGCTTATAATTTGACCTCAGTGCGCGATCCAGAAGAAATGCTA
GTTAAGCATATTATGGATAGTTTAGTCGTCAGTGTTCATCTTCAAGGGCA
ATCTTTTATTGATGTTGGTACGGGGCCGGGATTGCCGGGTATTCCGTTAG
CGATTGCTAATCCAGATAAACAGTTTGTCTTGTTAGATAGCTTAGGTAAA
CGTATTACTTTTATCAAGCAAGTATTACGTGAATTAGCCATTACGAATGT
TACACCGGTGCTTAGTCGGGTTGAGCAATATACCGCACGTCAGTTTGATG
GCGTATTAAGTCGTGCGTTTGCTTCATTAGATGATATGTTGAATTGGTGT
TATGCCTTACCTAACGATAGCGGAAAGTTTTATGCGTTAAAAGGTGTGTA
TGACGGCACTGAATTGCAAGCGGTTCAAAAGCCGATTAAATTAGTTGACG
CAATAAAACTTAATGTTCCTCAGTTAGTGGGGGAGCGCCATTTAATTGTA
TTAGCAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy