Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR7 IGR6 IGR3 IGR1497 IGR5 IGR1498 IGR1.1 IGR4 IGR1496 IGR1 IGR2 IGR1499 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpA, - HD0008 gidA, - HD0001 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpA, - HD0008 gidA, - HD0001 yckJ, - HD2033 yecC, - HD2032 yckK, - HD2035 HD2034 HD2034 atpE, - HD0005 HD0003 atpF, - HD0006 HD2037 atpH, - HD0007 gidB, - HD0002 atpA, - HD0004 atpA, - HD0008 gidA, - HD0001
* Calculated from Protein Sequence

Gene ID: HD0001

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gidA  

Definition:
glucose inhibited division protein A

Gene Start:
296

Gene Stop:
2188

Gene Length:
1893

Molecular Weight*:
70057

pI*:
7.30

Net Charge*:
2.20

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:

White DJ, Merod R, Thomasson B, Hartzell PL.
GidA is an FAD-binding protein involved in development of Myxococcus xanthus.
Mol Microbiol. 2001 Oct;42(2):503-17.
PMID: 11703671

Comment:
From GenBank (gi:12518597): The function of this protein may be
macromolecule synthesis. It may be involved in modification of DNA - replication, repair, restriction/modification. It is a glucose-inhibited division protein and is possibly involved in chromosome replication. See also GidB, HD0002.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to glucose inhibited division protein A; e.g. residues 1-629 are 80% similar to (U32739) glucose inhibited division protein of Haemophilus influenzae Rd, residues 1-627 are 71% similar to (AE000451) glucose-inhibited division; chromosome replication of Escherichia coli, residues 1-629 are 69% similar to (AE004343) glucose inhibited division protein A of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0445
COG name: NAD/FAD-utilizing enzyme apparently involved in cell division
Functional Class: D
The phylogenetic pattern of COG0445 is ----yqvceb-hujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002218 (Glucose inhibited division protein A family) with a combined E-value of 4.1e-273.
    IPB002218A    26-75
    IPB002218B    137-174
    IPB002218C    176-221
    IPB002218D    239-267
    IPB002218E    273-301
    IPB002218F    311-365
    IPB002218G    371-391
    IPB002218H    405-448
    IPB002218I    570-612
***** PR00368 (FAD-dependent pyridine nucleotide reductase signature) with a combined E-value of 1.8e-06.
    PR00368A    8-30
    PR00368C    8-33
***** IPB000447 (FAD-dependent glycerol-3-phosphate dehydrogenase) with a combined E-value of 8e-06.
    IPB000447A    7-59
    IPB000447C    140-162


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0001 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 406 (E-value = 2.1e-256) place HD0001 in the GIDA family which is described as Glucose inhibited division protein A (PF01134)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIYPEHYDVIVVGGGHAGTEAALAPARMGLKTLLLTHNVDTLGQMSCNPA
IGGIGKGHLVKEIDAMGGLMAIATDHAGIQFRTLNSSKGPAVRATRAQAD
RVLYRQSVRTALENQQNLAIFQQEVVDILVENHRASGVVTKMGLTFKAKT
VILTAGTFLAGKIHIGLDNYAGGRAGDPAATRLAERLRDLNLRVDRLKTG
TPPRLDARTINFEVLAKQPGDEVLPVMSFMGEVGQHPRQIPCYITHTNHQ
THDIIRANLDRSPMYTGIIEGIGPRYCPSIEDKVMRFGDRNGHQIYLEPE
GLTTIEVYPNGISTSLPFDVQMAIVNSMKGLENTRIIKAGYAIEYDYFDP
RDLKPTLETKAIEGLFFAGQINGTTGYEEAAAQGLLAGINAALQVQAKPS
WFPTRDVAYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTP
IAHQLGLIDEARWQRFNQKMENIERERERLKQIWIHPQSAYVDAVNQLVN
SPLTREVNGEDLLRRPEINYAKLTEIAAFAPALDDRQAAEQVEIAIKYQG
YIEHQYNEIERHKRHENTLIPAEFDYNKVDSLSNEVRAKLMQHRPISIGQ
ASRISGITPAAISILLVNLKKQGMLKRGEI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTATCCTGAACATTACGATGTCATTGTGGTAGGCGGTGGGCACGC
AGGTACAGAAGCGGCGCTTGCTCCAGCACGTATGGGATTAAAAACATTAT
TACTCACTCATAATGTGGATACTTTAGGGCAAATGTCTTGCAATCCTGCA
ATTGGTGGTATTGGTAAAGGCCATTTAGTTAAAGAGATTGATGCTATGGG
TGGTTTGATGGCCATCGCAACAGATCATGCAGGGATCCAATTTCGCACCC
TAAACAGTTCAAAAGGGCCGGCAGTAAGAGCAACACGTGCACAAGCGGAC
CGTGTTCTTTATCGTCAATCTGTGCGTACGGCATTAGAGAATCAGCAAAA
CTTAGCTATTTTTCAGCAAGAAGTGGTTGATATTTTAGTTGAAAATCATC
GCGCCAGTGGTGTTGTCACTAAAATGGGACTAACTTTTAAAGCCAAAACG
GTGATTTTAACCGCAGGAACATTTTTAGCGGGTAAGATCCATATTGGTTT
AGACAATTATGCCGGGGGACGAGCAGGCGATCCTGCGGCGACTAGATTAG
CAGAGCGATTGCGCGATCTTAATTTACGTGTAGATCGCTTAAAAACAGGT
ACACCACCACGCTTAGATGCACGTACCATTAATTTTGAGGTATTGGCCAA
ACAACCCGGAGATGAAGTCTTACCGGTAATGTCTTTTATGGGGGAGGTTG
GCCAACACCCGCGCCAGATCCCTTGCTATATCACCCATACAAATCATCAG
ACACACGATATTATTCGGGCTAATTTAGATCGAAGCCCTATGTATACCGG
AATTATTGAGGGGATCGGCCCGCGTTACTGCCCATCGATTGAAGATAAGG
TTATGCGTTTTGGTGATCGTAATGGACATCAGATCTACCTTGAGCCAGAA
GGATTAACGACCATTGAGGTGTATCCAAATGGTATTTCAACGAGTTTACC
TTTTGATGTACAAATGGCGATTGTTAATTCAATGAAAGGTTTAGAAAATA
CTCGAATTATTAAAGCAGGTTATGCGATTGAATATGACTATTTTGACCCG
CGTGATTTAAAACCAACCTTAGAAACTAAAGCGATTGAAGGCTTATTCTT
TGCGGGACAAATTAATGGCACGACCGGTTATGAAGAAGCCGCTGCACAAG
GCTTATTAGCGGGTATTAATGCCGCATTACAAGTACAAGCCAAGCCGAGT
TGGTTCCCTACTCGAGATGTTGCTTATACGGGAGTATTAGTTGACGACCT
CTGTACGCTTGGTACCAAAGAACCTTATCGTGTATTTACTTCTAGGGCTG
AATATCGCTTGCTCTTACGCGAAGATAATGCGGATATTCGTTTAACACCG
ATCGCACACCAATTAGGACTGATTGATGAAGCGCGTTGGCAACGTTTTAA
TCAAAAAATGGAAAATATAGAACGTGAGCGTGAACGGCTAAAACAAATAT
GGATTCATCCACAATCAGCCTATGTAGATGCGGTTAATCAATTAGTAAAT
TCACCATTAACCCGTGAAGTAAATGGTGAAGACTTATTGCGTCGCCCCGA
AATCAACTATGCTAAATTGACCGAAATAGCTGCTTTTGCTCCGGCATTAG
ACGATCGACAAGCGGCAGAACAAGTGGAAATCGCAATTAAGTATCAAGGC
TATATTGAACATCAATATAATGAAATTGAGCGACATAAACGCCATGAAAA
CACCTTAATTCCGGCTGAATTTGATTATAATAAAGTTGATAGCTTATCTA
ATGAAGTTCGCGCTAAATTAATGCAACATCGTCCTATTTCAATAGGGCAA
GCAAGCCGTATTTCAGGTATCACTCCAGCCGCTATTTCAATTTTGTTAGT
CAATTTGAAAAAGCAAGGAATGCTCAAGCGAGGCGAGATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy