Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR838 IGR833 IGR835 IGR834 IGR837 IGR839 IGR836 CPn1051 CPn1056 CPn1052 CPn1055 dapA, - CPn1050 lysC, - CPn1049 CPn1057 CPn1054 CPn1051 CPn1056 CPn1052 CPn1055 dapA, - CPn1050 lysC, - CPn1049 CPn1057 CPn1054 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 CPn1056 CPn1052 CPn1055 dapA, - CPn1050 lysC, - CPn1049 CPn1057 CPn1054 CPn1053 CPn1053 CPn1051
* Calculated from Protein Sequence

Gene ID: CPn1054

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
1207034

Gene Stop:
1209469

Gene Length:
2436

Molecular Weight*:
93450

pI*:
5.80

Net Charge*:
-10.99

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
No significant similarity to C.trachomatis.

Blast Summary:  PSI-Blast Search
No hits in gapped BLAST, beyond those representing paralogs. No similarity to C.trachomatis, T.pallidum or M.genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
CPn1054 is paralogously related to several CPn hypothetical proteins; in order
of similarity: CPn1056, CPn0046, CPn0124, CPn0044, CPn0011, CPn0225, CPn0585,
CPn0186, CPn0125, CPn1055, CPn0042, CPn0007, CPn0126, CPn0008.



Pfam Summary:  Pfam Search
Residues 38 to 253 (E-value = 9e-86) place CPn1054 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
184
coil-coil  
377  
490
coil-coil  
504  
554
coil-coil  
642  
669

PDB Hit:


Gene Protein Sequence:
MQVLLSPQLPPPPQHSVGSISSPSKLRVLAITFLVFGMLLLISGALFLTL
GIPGLSAAISFGLGIGLSALGGVLMISGLLCLLVKREIPTVRPEEIPEGV
SLAPSEEPALQAAQKTLAQLPKELDQLDTDIQEVFACLRKLKDSKYESRS
FLNDAKKELRVFDFVVEDTLSEIFELRQIVAQEGWDLNFLINGGRSLMMT
AESESLDLFHVSKRLGYLPSGDVRGEGLKKSAKEIVARLMSLHCEIHKVA
VAFDRNSYAMAEKAFAKALGALEESVYRSLTQSYRDKFLESERAKIPWNG
HITWLRDDAKSGCAEKKLRDAEERWKKFRKAVFWVEEDGGFDINNLLGDW
GTVLDPYRQERMDEITFHELYEKTTFLKRLHRKCALAKTTFEKKRSKKNL
QAVEEANARRLKYVRDWYDQEFQKAGERLEKLHALYPEVSVSIRENKIQE
TRSNLEKAYEAIEENYRCCVREQEDYWKEEEKREAEFRERGNKILSPEEL
ESSLEQFDHGLKNFSEKLMELEGHILKLQKEATAEVENKILSDAESRLEI
VFEDVKEMPCRIEEIEKTLRMAELPLLPTKKAFEKACSQYNSCAEMLEKV
KPYCKESLAYVTSKERLVSLDEDLRRAYTECQKRFQGDSGLESEVRACRE
QLRERIQEFETQGLDLVEKELLCVSSRLRNTECDCVSGVKKEAPPGKKFY
AQYYDEIYRVRVQSRWMTMSERLREGVQACNKMLKAGLSEEDKVLKEEEY
WLYREERKNKEKRLVGTKIVATQQRVAAFESIEVPEIPEAPEEKPSLLDK
ARSLFTREDHT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGTACTTCTATCTCCGCAGCTACCCCCCCCCCCCCAACACTCTGT
AGGGTCGATTTCTTCTCCATCTAAACTTCGCGTTTTAGCGATTACTTTTT
TAGTTTTTGGTATGCTCTTACTGATTTCAGGAGCTCTCTTTCTGACGTTA
GGGATTCCAGGATTGAGTGCAGCAATTTCTTTTGGATTAGGCATCGGTCT
CTCCGCATTAGGAGGAGTGCTGATGATTTCGGGACTACTATGTCTTTTAG
TAAAACGAGAGATTCCGACAGTACGACCAGAAGAAATTCCTGAAGGGGTT
TCGCTGGCTCCTTCTGAGGAGCCAGCTCTACAGGCAGCTCAGAAGACTTT
AGCTCAGCTGCCTAAGGAATTGGATCAGTTAGATACAGATATTCAGGAAG
TGTTCGCATGTTTAAGAAAGCTGAAAGATTCTAAGTATGAAAGTCGAAGT
TTTTTAAACGATGCTAAGAAGGAGCTTCGAGTTTTTGACTTTGTGGTTGA
GGATACCCTCTCGGAGATTTTCGAGTTGCGGCAGATTGTGGCTCAAGAGG
GATGGGATTTAAACTTTTTGATCAATGGGGGACGAAGCCTCATGATGACT
GCAGAATCTGAATCGCTTGATTTGTTTCATGTATCGAAGCGGCTAGGGTA
TTTACCTTCTGGGGATGTTCGAGGGGAGGGGTTAAAGAAATCTGCGAAGG
AGATAGTCGCTCGTTTGATGAGCTTGCATTGCGAGATTCACAAGGTGGCG
GTAGCGTTTGATAGGAATTCCTATGCGATGGCAGAAAAGGCGTTTGCGAA
AGCGTTGGGAGCTTTAGAAGAGAGTGTGTATCGGAGTCTGACGCAGAGTT
ATAGAGATAAATTTTTGGAGAGCGAGAGGGCGAAGATCCCATGGAATGGG
CATATAACCTGGTTAAGAGATGATGCGAAGAGTGGGTGTGCTGAAAAGAA
GCTTCGGGATGCCGAGGAACGTTGGAAGAAATTTAGGAAAGCAGTCTTTT
GGGTAGAAGAAGACGGGGGCTTTGACATCAATAATCTCCTTGGAGACTGG
GGGACAGTGCTTGATCCTTATAGACAAGAGAGAATGGACGAGATAACGTT
CCATGAGTTGTATGAAAAAACTACGTTTTTGAAAAGACTGCACAGAAAGT
GTGCGTTAGCGAAAACAACCTTTGAAAAGAAGAGATCTAAAAAGAATTTG
CAGGCAGTCGAGGAGGCGAATGCACGTAGGTTGAAATATGTAAGGGATTG
GTATGATCAGGAGTTTCAGAAAGCAGGGGAGAGATTAGAGAAACTGCATG
CTTTGTATCCTGAGGTTTCAGTCTCTATAAGAGAGAACAAAATACAAGAG
ACGCGCTCTAATTTAGAGAAAGCCTATGAGGCTATCGAAGAGAACTATCG
TTGCTGTGTCCGAGAGCAAGAGGACTACTGGAAAGAAGAAGAGAAAAGGG
AAGCGGAGTTTAGGGAGAGGGGAAACAAGATTCTTTCTCCTGAGGAGCTG
GAAAGTTCTTTGGAGCAATTCGACCATGGTTTGAAAAATTTTTCTGAGAA
ATTAATGGAATTGGAAGGGCATATCTTAAAACTTCAGAAAGAAGCCACAG
CAGAGGTGGAGAATAAAATACTTTCAGATGCAGAGAGCCGCCTTGAGATT
GTATTTGAAGATGTCAAGGAGATGCCCTGTCGAATTGAGGAGATAGAGAA
GACGCTGCGTATGGCGGAGCTGCCCCTACTTCCTACGAAGAAGGCGTTTG
AGAAGGCCTGCTCACAATATAATAGCTGCGCAGAGATGTTGGAGAAGGTG
AAGCCTTACTGCAAGGAGAGCCTCGCCTATGTGACTAGCAAAGAGCGTTT
AGTGAGCTTGGATGAAGATTTACGACGAGCCTACACAGAGTGTCAGAAGA
GATTCCAGGGGGATTCGGGTTTGGAGTCGGAAGTAAGAGCCTGTCGAGAG
CAACTGCGAGAGCGGATCCAAGAGTTTGAAACTCAAGGGCTGGACTTGGT
GGAAAAAGAGTTGCTTTGTGTGAGTAGTAGATTAAGAAATACAGAGTGCG
ATTGTGTATCTGGTGTTAAGAAAGAAGCACCTCCTGGTAAGAAGTTTTAT
GCCCAGTATTATGATGAGATTTATCGAGTTAGAGTTCAATCCCGATGGAT
GACGATGTCTGAGAGATTGAGAGAGGGAGTTCAAGCATGCAACAAGATGT
TGAAGGCAGGCCTAAGCGAAGAAGATAAGGTTCTTAAAGAAGAAGAGTAT
TGGTTGTATCGAGAGGAGAGAAAGAATAAAGAGAAACGTTTGGTTGGTAC
TAAGATAGTAGCAACGCAGCAGCGAGTTGCAGCATTTGAATCCATAGAAG
TTCCTGAGATTCCTGAGGCCCCAGAGGAGAAACCGAGTTTGCTGGATAAA
GCGCGTTCTTTATTTACTCGCGAGGACCATACCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy