Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR833 IGR835 IGR834 IGR831 IGR832 IGR836 bioB, - CPn1044 CPn1046 CPn1051 CPn1052 dapB, - CPn1047 dapA, - CPn1050 lysC, - CPn1049 CPn1054 bioB, - CPn1044 CPn1046 CPn1051 CPn1052 dapB, - CPn1047 dapA, - CPn1050 lysC, - CPn1049 CPn1054 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 bioB, - CPn1044 CPn1046 CPn1045 CPn1045 CPn1052 dapB, - CPn1047 dapA, - CPn1050 lysC, - CPn1049 CPn1054 CPn1053 asd, - CPn1048 asd, - CPn1048 CPn1053 CPn1051
* Calculated from Protein Sequence

Gene ID: CPn1049

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lysC  

Definition:
aspartokinase-I

Gene Start:
1202595

Gene Stop:
1203917

Gene Length:
1323

Molecular Weight*:
48338

pI*:
4.70

Net Charge*:
-18.27

EC:
2.7.2.4  

Functional Class:
amino acid biosynthesis; aspartate family  

Pathway: pathway table
Glycine, serine and threonine metabolism
Lysine biosynthesis

Comment:
This enzyme catalyzes two nonconsecutive steps in amino acid biosynthetic
pathways, 1) taking homoserine to aspartate semialdehyde (EC 1.1.1.3) and 2)
taking aspartate to aspartyl phosphate (EC 2.7.2.4). The enzyme is a
homotetramer. An aspartokinase -II/homoserine dehydrogenase -II and an
aspartokinase-III are also sometimes present, but apparently not in
C.trachomatis.

From Prosite PDOC00289:

Aspartokinase (EC 2.7.2.4) (AK) catalyzes the phosphorylation of aspartate.
The product of this reaction can then be used in the biosynthesis of lysine
or in the pathway leading to homoserine, which participates in the
biosynthesis of threonine, isoleucine and methionine.

In Escherichia coli, there are three different isozymes which differ in their
sensitivity to repression and inhibition by Lys, Met and Thr. AK1 (gene thrA)
and AK2 (gene metL) are bifunctional enzymes which both consist of an
N-terminal AK domain and a C-terminal homoserine dehydrogenase domain. AK1 is
involved in threonine biosynthesis and AK2, in that of methionine. The third
isozyme, AK3 (gene lysC), is monofunctional and involved in lysine synthesis.
In yeast, there is a single isozyme of AK (gene HOM3).

Blast Summary:  PSI-Blast Search
CPn1049 is orthologously related to CT362, a predicted asprtokinase-I: residues
4-429 are 41% similar to CT362. No similarity to T.pallidum or
M.genitalium.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0527
COG name: Aspartokinases
Functional Class:  E
The phylogenetic pattern of COG0527 is amtKyqVcEBrHuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 266 (E-value = 3.4e-55) place CPn1049 in the AA_kinase family which is described as Amino acid kinase family (PF00696)

PDB Hit:


Gene Protein Sequence:
VSKIVYKFGGTSLATAENICLVCDIICKDKPSFVVVSAIAGVTDLLVDFC
SSSLREREEVLRKIEGKHEEIVKNLAIPFPVSTWTSRLLPYLQHLEISDL
DFARILSLGEDISASLVRAVCSTRGWDLGFLEARSVILTDDSYRRASPNL
DLMKAHWHQLELNQPSYIIQGFIGSNGLGETVLLGRGGSDYSATLIAELA
RATEVRIYTDVNGIYTMDPKVISDAQRIPELSFEEMQNLASFGAKVLYPP
MLFPCMRAGIPIFVTSTFDPEKGGTWVYAVDKSVSYEPRIKALSLSQYQS
FCSVDYTVLGCGGLEEILGILESHGIDPELMIAQNNVVGFVMDDDIISQE
AQEHLVDVLSLSSVTRLHHSVALITMIGDNLSSPKVVSTITEKLRGFQGP
VFCFCQSSMALSFVVASELAEGIIEELHNDYVKQKAIVAT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCTAAGATAGTTTATAAATTTGGTGGCACTAGCTTAGCAACTGCTGA
GAATATCTGTTTGGTTTGTGATATCATTTGCAAAGATAAGCCTTCTTTTG
TTGTTGTAAGCGCAATCGCCGGTGTGACGGACCTCCTTGTAGACTTCTGC
TCGTCTTCTTTAAGAGAACGAGAGGAGGTCTTAAGAAAAATAGAGGGAAA
ACATGAGGAGATTGTAAAAAACCTAGCGATTCCTTTTCCTGTCTCTACAT
GGACGTCTCGACTCCTTCCCTATCTACAACATCTGGAGATCTCAGATCTC
GATTTTGCTCGTATTTTGTCTTTAGGAGAAGATATTTCAGCTTCCCTAGT
TCGTGCTGTTTGTAGCACCCGTGGTTGGGATTTAGGATTTCTCGAGGCAC
GTAGTGTCATCTTAACAGACGATAGCTACCGACGTGCCTCTCCAAACCTA
GATCTTATGAAAGCACATTGGCATCAGCTCGAACTAAATCAGCCTTCGTA
TATTATCCAGGGGTTCATCGGATCTAATGGTTTGGGAGAAACAGTTCTTC
TTGGGCGCGGAGGCAGTGATTATTCAGCAACTTTGATCGCAGAGCTTGCA
AGAGCAACAGAAGTGCGTATTTATACCGATGTTAATGGGATCTATACCAT
GGATCCTAAAGTGATTTCCGATGCACAGCGCATTCCTGAGCTCAGTTTCG
AAGAGATGCAGAATTTAGCAAGTTTTGGTGCTAAAGTCCTTTATCCTCCT
ATGCTCTTTCCTTGTATGCGTGCGGGAATTCCTATTTTTGTGACATCAAC
ATTTGACCCTGAAAAAGGAGGAACATGGGTCTATGCTGTCGATAAGTCTG
TGAGTTATGAACCAAGAATAAAAGCTTTATCCTTAAGTCAATACCAAAGC
TTCTGTTCTGTAGACTATACTGTCCTAGGATGTGGGGGATTAGAAGAGAT
TTTAGGCATTTTAGAATCCCATGGGATAGATCCTGAATTGATGATAGCAC
AAAACAACGTCGTTGGATTTGTAATGGATGATGATATCATTTCTCAAGAA
GCTCAAGAGCACCTTGTAGATGTTTTATCGCTATCTAGTGTCACACGCTT
GCATCATAGTGTTGCATTGATTACCATGATCGGAGATAATCTTTCTTCTC
CAAAAGTTGTCTCAACAATTACGGAGAAACTCAGAGGTTTTCAAGGACCT
GTATTTTGTTTTTGCCAAAGTTCAATGGCATTAAGCTTTGTTGTTGCCTC
AGAGTTGGCAGAGGGTATTATAGAAGAATTACATAATGATTATGTAAAAC
AAAAAGCTATAGTCGCCACGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy