Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR776 IGR778 IGR775 IGR773 IGR777 IGR774 IGR781 IGR780 IGR779 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0977 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0977 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0977 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969
* Calculated from Protein Sequence

Gene ID: CPn0973

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucC  

Definition:
succinyl-CoA synthetase beta subuni

Gene Start:
1116370

Gene Stop:
1117530

Gene Length:
1161

Molecular Weight*:
41914

pI*:
5.10

Net Charge*:
-12.56

EC:
6.2.1.5  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table
CarbohydrateMetabolism; Citrate cycle (TCA cycle)

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or
U. urealyticum sequences.

CPn0973 is orthologously related to CT821, a predicted succinyl-CoA synthetase beta subunit.
Residues 1-385 are 67% similar to CT821.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0045
COG name: Succinyl-CoA synthetase beta chain
Functional Class:  C
The phylogenetic pattern of COG0045 is Amt-yQ-cebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 29 to 198 (E-value = 8.3e-29) place CPn0973 in the ATP-grasp family which is described as ATP-grasp domain (PF02222)
Residues 246 to 382 (E-value = 1.2e-46) place CPn0973 in the Ligase_CoA family which is described as CoA-ligase (PF00549)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
60  
77
transmembrane  
94  
111
transmembrane  
252  
269
transmembrane  
314  
331

PDB Hit:


Gene Protein Sequence:
MHLHEYQAKDLLASYDVPIPPYWVVSSEEEGELLITKSGLDSAVVKVQVH
AGGRGKHGGVIVAKSSAGILQAVAKLLGMHFTSNQTADGFLPVEKVLISP
LVAIQREYYVAVIMDRKHRCPVLMLSKAGGMDIEEVAHSSPEQILTLPLT
SYGHIYSYQLRQATKFMEWEGEVMHQGVQLIKKLAKCFYENDVSLLEINP
LVLTLEGELLVLDSKITIDDNALYRHPNLEVLYDPSQENVRDVLAKQIGL
SYIALSGNIGCIVNGAGLAMSTLDILKLHGGNAANFLDVGGGASQKQIQE
AVSLVLSDESVKVLFINIFGGIMDCSVVASGLVAVMETRDQVVPTVIRLE
GTNVELGKEIVQQSGIPCQFVSSMEEGARRAVELSM$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCTTCATGAGTACCAAGCTAAAGATCTCTTAGCTTCTTACGATGT
GCCTATTCCCCCCTATTGGGTAGTGTCTTCAGAGGAAGAAGGGGAACTTC
TTATCACAAAGTCGGGATTAGATTCCGCCGTGGTTAAAGTACAGGTTCAT
GCTGGAGGTCGAGGGAAACATGGTGGTGTCATTGTTGCAAAATCCTCAGC
AGGCATTTTGCAAGCCGTAGCTAAGCTCTTAGGAATGCATTTTACTAGTA
ATCAAACTGCCGACGGATTTCTCCCCGTAGAGAAAGTCTTGATTTCACCA
CTTGTTGCTATACAAAGGGAATATTATGTCGCAGTGATTATGGATCGAAA
ACACCGATGCCCAGTTCTTATGCTTTCAAAAGCAGGAGGTATGGATATCG
AAGAGGTCGCACACTCTTCCCCAGAACAGATCCTGACATTACCACTGACC
TCTTATGGGCATATCTATAGTTATCAACTTCGTCAAGCCACTAAGTTCAT
GGAGTGGGAAGGAGAAGTGATGCACCAAGGTGTCCAATTGATCAAAAAGC
TTGCGAAGTGCTTTTATGAAAATGATGTCTCTTTATTAGAGATCAATCCT
TTGGTGTTGACTTTAGAGGGTGAGCTACTTGTCCTCGATTCTAAGATTAC
GATCGATGACAATGCCCTATACCGTCATCCCAACTTAGAAGTATTGTATG
ACCCCTCTCAAGAGAATGTTCGGGATGTCCTAGCAAAGCAAATCGGATTG
TCCTACATCGCTCTAAGCGGAAATATCGGTTGCATTGTGAATGGCGCCGG
ACTTGCCATGAGTACCTTAGATATTTTAAAGCTCCATGGTGGGAATGCTG
CGAATTTCTTAGATGTCGGAGGAGGGGCTTCTCAAAAGCAAATCCAAGAA
GCTGTATCTTTAGTATTGTCCGATGAGAGCGTGAAAGTGCTTTTTATCAA
TATCTTCGGGGGGATTATGGACTGTTCTGTAGTTGCCTCCGGGCTCGTTG
CAGTTATGGAAACAAGAGATCAAGTGGTTCCTACAGTCATTCGTCTCGAA
GGAACAAATGTAGAATTGGGAAAAGAAATTGTTCAGCAATCTGGGATTCC
TTGCCAATTTGTCTCTTCTATGGAAGAGGGCGCTAGACGCGCTGTAGAAC
TGAGTATGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy