Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR776 IGR778 IGR775 IGR773 IGR777 IGR774 IGR772 IGR780 IGR779 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 CPn0976 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968
* Calculated from Protein Sequence

Gene ID: CPn0972

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ftsY  

Definition:
cell division protein

Gene Start:
1116299

Gene Stop:
1115427

Gene Length:
873

Molecular Weight*:
31745

pI*:
7.50

Net Charge*:
1.07

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to cell division protein sequences; e.g. residues 15-266 are 39% similar to FTSY_HAEIN; residues 11-266 are 37% similar to FTSY_ECOLI; residues 15-266 are 36% similar to (AE000714) cell division protein FtsY [Aquifex aeolicus]; residues 1-283 are 61% similar to CT820, a signal recognition particle sequence; residues 9-283 are 34% similar to UU141; residues 86-280 are 41% similar to MG297; residues 26-281 are 33% similar to TP0578; and residues 20-275 are 29% similar to CT025.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0552
COG name: Signal recognition particle GTPase FtsY
Functional Class: N
The phylogenetic pattern of COG0552 is amtkyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 84-129, 150-203, and 221-271 represent blocks BL00200B-D (SRP54-type proteins GTP-binding domain proteins) with a combined E-value of 1.6e-42.

ProDom Summary:  Protein Domain Search
Residues 86-284 are 47% similar to a defined domain of FTSY_HAEIN, defined as: SIGNAL RECOGNITION PARTICLE PROTEIN GTP-BINDING RNA-BINDING HOMOLOG SRP54 CELL DIVISION.

Paralogs:  Local Blast Search
Probable paralog is CPn0115, a predicted Signal Recognition Particle GTPase. Residues 81-275 are 32% similar.

Pfam Summary:  Pfam Search
Residues 83 to 285 (E-value = 7.9e-94) place CPn0972 in the SRP54 family which is described as SRP54-type protein, GTPase domain (PF00448)

PDB Hit:


Gene Protein Sequence:
MFKFFRNKLQSLFKKNISLDLIEDAESLFYEADFGTELTEELCARLRRTK
KADASTIKDLITVLLRESLEGLPSQASQSSQTRPIVSLLLGTNGSGKTTT
AAKLAHYYKERSESVMLVATDTFRAAGMDQARLWANELGCGFVSGQPGGD
AAAIAFDGIQSAIARGYSRVIIDTSGRLHVHGNLMKELSKIVSVCGKALE
GAPHEIFMTVDSTLGNNAIEQVRVFHDVVPLSGLIFTKVDGSAKGGTLFQ
IAKRLKIPTKFIGYGESLKDLNEFDLDLFLNKLFPEVEKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAAATTCTTTAGAAACAAGCTTCAATCTTTATTTAAAAAAAATAT
ATCTTTAGATCTTATAGAAGATGCTGAAAGTTTGTTTTATGAAGCAGATT
TTGGTACTGAGCTTACTGAAGAATTGTGTGCACGATTACGTCGGACTAAA
AAAGCTGACGCATCTACTATCAAAGATCTGATTACAGTTTTACTTCGCGA
GTCTCTAGAAGGTCTTCCTTCTCAAGCTTCACAAAGTTCCCAGACCAGAC
CGATTGTTTCTTTACTTCTTGGGACCAACGGCTCAGGAAAAACGACAACA
GCGGCCAAACTTGCTCATTACTACAAAGAGCGATCTGAAAGCGTCATGCT
TGTAGCCACGGATACCTTTCGAGCTGCTGGCATGGACCAGGCACGACTCT
GGGCCAACGAACTTGGCTGTGGCTTTGTCTCTGGACAACCCGGGGGGGAC
GCTGCTGCTATTGCCTTTGATGGGATTCAATCTGCAATCGCCCGGGGGTA
CTCTAGAGTCATTATTGATACCTCAGGTCGCCTGCATGTACATGGCAATC
TTATGAAAGAGCTTTCCAAAATAGTCTCGGTTTGCGGCAAAGCTCTAGAG
GGAGCTCCTCATGAAATTTTTATGACTGTGGACTCTACCTTAGGGAATAA
TGCTATAGAGCAGGTGCGGGTATTTCATGATGTTGTTCCCCTTTCTGGTC
TTATCTTCACAAAAGTAGACGGCTCTGCCAAGGGTGGCACCCTATTTCAA
ATAGCTAAACGACTGAAAATCCCCACAAAGTTTATTGGTTATGGGGAATC
TTTAAAGGATCTTAATGAATTCGACTTAGATCTTTTTCTAAACAAATTAT
TTCCTGAAGTAGAAAAGATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy