Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR776 IGR778 IGR775 IGR773 IGR777 IGR774 IGR772 IGR780 IGR779 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 CPn0969.1 CPn0975 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 glmS, - CPn0968
* Calculated from Protein Sequence

Gene ID: CPn0971

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yccA_2  

Definition:
conserved hypothetical protein (integral membrane protein, possible permease)

Gene Start:
1114702

Gene Stop:
1115418

Gene Length:
717

Molecular Weight*:
26179

pI*:
9.30

Net Charge*:
4.79

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to conserved hypothetical protein sequences; e.g. residues 1-237 are 70% similar to CT819, a conserved hypothetical protein (integral membrane protein, possible permease); residues 17-237 are 33% similar to YBHL_ECOLI; residues 10-236 are 27% similar to (AE001155) conserved hypothetical integral membrane protein [Borrelia burgdorferi]; and residues 21-237 are 29% similar to (AJ235270) unknown [Rickettsia prowazekii].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0670
COG name: Integral membrane protein YccA, interacts with FtsH
Functional Class:  R
The phylogenetic pattern of COG0670 is ----y--cEb-huj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 108-142 and 203-237 represent blocks BL01243C-D (Uncharacterized protein family UPF0005 proteins) with a combined E-value of 0.0088.

ProDom Summary:  Protein Domain Search
Residues 96-229 are 32% similar to a defined domain of O51489_BORBU, defined as: PROTEIN TRANSMEMBRANE INTERGENIC REGION TEGT CONSERVED INTEGRAL MEMBRANE TESTIS ENHANCED.
Residues 89-233 are 31% similar to a defined domain of YBHL_ECOLI, defined as: PROTEIN TRANSMEMBRANE INTERGENIC REGION TEGT CONSERVED INTEGRAL MEMBRANE TESTIS ENHANCED.
Residues 97-230 are 27% similar to a defined domain of Q24417_DROME, defined as: PROTEIN TRANSMEMBRANE INTERGENIC REGION TEGT CONSERVED INTEGRAL MEMBRANE TESTIS ENHANCED.

Paralogs:  Local Blast Search
Residues 1-76 are 98% similar to CPn0969.1, a predicted Transport Permease (truncated).

Pfam Summary:  Pfam Search
Residues 11 to 235 (E-value = 5.8e-06) place CPn0971 in the UPF0005 family which is described as Uncharacterised protein family UPF0005 (PF01027)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
51
transmembrane  
56  
75
transmembrane  
80  
97
transmembrane  
106  
127
transmembrane  
142  
166
transmembrane  
171  
188
transmembrane  
211  
228

PDB Hit:


Gene Protein Sequence:
MGLYDRDYIQDSRVQGTFASRVYGWMTAGLIVTSCVALGLYFSGLYRSLF
SFWWVWCFATLGVSFFINSKIQTLSVSAVGGLFLLYSTLEGMFFGTLLPV
YAAQYGGGVIWAAFGSAALVFGLAAVYGAFTKSDLTKISKIMTFALIGLL
LVTLVFAVVSMFVSMPLIYLLICYLGLVIFVGLTAADAQAIRRISSTIGD
NNTLSYKLSLMFALKMYCNVIMVFWYLLQIFSSSGNRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGACTATATGATCGTGACTATATACAAGATTCTCGAGTGCAGGGAAC
TTTTGCTTCAAGAGTCTATGGGTGGATGACAGCAGGGCTAATCGTAACTT
CATGTGTTGCCCTGGGTCTTTATTTTTCTGGATTATACAGAAGTTTATTT
TCTTTTTGGTGGGTGTGGTGTTTCGCTACGCTAGGCGTGTCTTTCTTTAT
CAACTCTAAAATCCAGACACTATCGGTTTCTGCTGTAGGGGGCCTTTTCC
TTCTCTACTCAACATTAGAAGGAATGTTTTTTGGAACCTTACTTCCTGTC
TACGCTGCTCAATATGGCGGAGGGGTGATCTGGGCCGCTTTTGGATCAGC
AGCCTTGGTATTTGGCTTAGCAGCAGTATACGGAGCGTTTACAAAAAGCG
ATCTTACTAAAATTAGTAAGATTATGACTTTTGCTTTGATAGGACTTCTG
CTAGTGACTCTAGTCTTTGCTGTGGTTTCGATGTTTGTATCTATGCCTTT
AATCTACTTATTGATTTGCTATCTAGGGCTCGTCATCTTTGTTGGATTGA
CAGCTGCTGATGCGCAAGCAATTCGTCGGATTTCTTCTACTATAGGGGAT
AACAATACCTTGAGTTACAAACTCTCTTTGATGTTTGCTCTTAAGATGTA
TTGCAATGTCATCATGGTATTTTGGTATCTGCTGCAGATTTTCTCATCTT
CAGGAAACCGAGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy