Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR771 IGR776 IGR778 IGR775 IGR773 IGR777 IGR774 IGR772 IGR770 ftsY, - CPn0972 CPn0969.1 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 ftsY, - CPn0972 CPn0969.1 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 CPn0969.1 yccA_2, - CPn0971 sucD, - CPn0974 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968
* Calculated from Protein Sequence

Gene ID: CPn0969.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
1113053

Gene Stop:
1113373

Gene Length:
321

Molecular Weight*:
11922

pI*:
8.40

Net Charge*:
1.84

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Residues 75-106 are of CPn0969.1 are 90% similar residues 578-609 of CPn0968, a predicted glucosamine-fructose-6-P aminotransferase sequence.

Blast Summary:  PSI-Blast Search
CPn0969.1 is orthologously related to CT819: residues 1-86 of CPn0969.1 are 65% similar to residues 1-89 of CT819, a predicted Chlamydia-specific hypothetical protein from C. trachomatis. No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 73-106 are 64% similar to a defined domain of O19908_XXXXX, defined as: AMINOTRANSFERASE AMIDOTRANSFERASE ISOMERIZING GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE GFAT TRANSFERASE HEXOSEPHOSPHATE D-FRUCTOSE-6- PHOSPHATE PROTEIN.

Paralogs:  Local Blast Search
CPn0969.1 is paralogous to CPn0971: residues 1-76 are 98% similar to residues 1-98 of CPn0971, a predicted transport permease from C. pneumoniae.

residues 75-106 are 90% similar to CPn0968, a predicted Glucosamine-Fructose-6-P Aminotransferase sequence.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
44
transmembrane  
49  
68
transmembrane  
73  
90

PDB Hit:


Gene Protein Sequence:
MGLYDRDYIQDSRVQGTFASRVYGWMTAGLIVTSCVALGLYFSGLYRSLF
SFWWMWCFATLGVSFFINSKIQTLSVVGQVMAYAMVLAKGMEIDCPRNLA
KSVTVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGACTATATGATCGTGACTATATACAAGATTCTCGAGTGCAGGGAAC
TTTTGCTTCAAGAGTCTATGGGTGGATGACAGCAGGGCTAATCGTAACTT
CATGTGTTGCCCTGGGTCTTTATTTTTCTGGATTATACAGAAGTTTATTT
TCTTTTTGGTGGATGTGGTGTTTCGCTACGCTAGGCGTGTCTTTCTTTAT
CAACTCTAAAATCCAGACACTATCGGTAGTTGGTCAAGTGATGGCATATG
CTATGGTGTTAGCAAAAGGAATGGAGATTGACTGTCCCAGAAATCTTGCC
AAGTCTGTTACTGTAGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy