Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR771 IGR776 IGR775 IGR773 IGR777 IGR774 IGR772 IGR770 ftsY, - CPn0972 pcnB_2, - CPn0966 CPn0969.1 yccA_2, - CPn0971 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 ftsY, - CPn0972 pcnB_2, - CPn0966 CPn0969.1 yccA_2, - CPn0971 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 pcnB_2, - CPn0966 CPn0969.1 yccA_2, - CPn0971 sucC, - CPn0973 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968
* Calculated from Protein Sequence

Gene ID: CPn0969

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrP_1  

Definition:
tyrosine/tryptophan-specific transport protein

Gene Start:
1111812

Gene Stop:
1113002

Gene Length:
1191

Molecular Weight*:
43581

pI*:
9.90

Net Charge*:
14.24

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
See CPn0970.

In H.influenzae, this is an integral membrane protein that facilitates transport of tyrosine and tryptophan across the cell membrane.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to tyrosine and tryptophan transport protein sequences; e.g. residues 1-392 are 57% similar to CT817, a predicted tyrosine/tryptophan-specific transport protein; residues 1-394 are 54% similar to CT818, a tyrosine/tryptophan specific transport protein; residues residues 3-387 are 30% similar to TRYP_HAEIN; residues 1-383 are 29% similar to TRYP_ECOLI; residues 2-391 are 26% similar to MTR_HAEIN; and residues 2-382 are 25% similar to MTR_ECOLI.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0814
COG name: Amino acid permeases
Functional Class:  E
The phylogenetic pattern of COG0814 is ----Y---E--Huj----IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 8-358 span six regions of similarity to blocks BL00594A-F (Aromatic amino acids permeases proteins) with a combined E-value of 1.3e-42.

ProDom Summary:  Protein Domain Search
Residues 119-389 are 33% similar to a defined domain of TYRP_ECOLI, defined as: TRANSPORT PERMEASE AMINO-ACID TRANSMEMBRANE INNER MEMBRANE PROTEIN TRYPTOPHAN TYROSINE TYROSINE-SPECIFIC.
Residues 128-308 are 29% similar to a defined domain of O22778_ARATH, defined as: PUTATIVE TYROSINE-SPECIFIC TRANSPORT PROTEIN (TYRP).

Paralogs:  Local Blast Search
Residues 1-396 are 100% similar to CPn0970.

Pfam Summary:  Pfam Search
Residues 1 to 391 (E-value = 6.4e-218) place CPn0969 in the Trp_Tyr_perm family which is described as Tryptophan/tyrosine permease family (PF03222)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
18
transmembrane  
30  
52
transmembrane  
82  
99
transmembrane  
125  
144
transmembrane  
154  
174
transmembrane  
182  
204
transmembrane  
224  
244
transmembrane  
271  
291
transmembrane  
314  
331
transmembrane  
336  
354
transmembrane  
376  
393

PDB Hit:


Gene Protein Sequence:
MSNKVLGGSLLIAGSAIGAGVLAVPVLTAKGGFFPATFLYIVSWLFSMAS
GLCLLEVMTWMKESKNPVNMLSMAESILGHVGKISICLVYLFLFYSLLIA
YFCEGGNILCRVFNCQNLGISWIRHLGPLGFAILMGPIIMAGTKVIDYCN
RFFMFGLTVAFGIFCALGFLKIQPSFLVRSSWLTTINAFPVFFLAFGFQS
IIPTLYYYMDKKVGDVKKAILIGTLIPLVLYVLWEVVVLGAVSLPILSQA
KIGGYTAVEALKQAHRSWAFYIAGELFGFFALVSSFVGVALGVMDFLADG
LKWNKKSHPFSIFFLTFIIPLAWAVCYPEIVLTCLKYAGGFGAAVIIGVF
PTLIVWKGRYGKQHHREKQLVPGGKFALFLMFLLIVINVVSIYHEL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAATAAAGTTCTAGGTGGGTCCTTGCTTATTGCAGGTTCTGCCAT
CGGTGCTGGTGTTTTAGCAGTTCCTGTATTGACCGCAAAAGGCGGTTTTT
TCCCTGCAACTTTTCTCTATATTGTCTCCTGGCTTTTTTCTATGGCCTCA
GGCCTTTGCCTTCTTGAAGTCATGACTTGGATGAAAGAATCAAAGAACCC
AGTGAACATGCTTTCTATGGCGGAATCTATTTTAGGTCATGTAGGCAAGA
TTTCTATATGCCTTGTCTACTTGTTTCTCTTTTACTCCCTACTGATTGCC
TATTTCTGCGAAGGGGGAAACATCTTATGCCGCGTGTTTAATTGTCAAAA
TTTAGGAATCTCGTGGATTCGTCACCTTGGCCCTCTAGGTTTTGCTATAT
TGATGGGGCCTATCATTATGGCGGGAACAAAAGTGATTGATTACTGTAAT
CGTTTCTTTATGTTCGGCTTAACTGTAGCTTTTGGAATTTTCTGTGCCCT
TGGATTTTTAAAAATCCAACCTAGCTTTCTGGTGCGTTCCTCATGGTTAA
CTACAATAAACGCATTTCCTGTGTTTTTCCTTGCTTTTGGATTCCAAAGT
ATCATTCCTACGTTGTACTACTACATGGACAAAAAAGTTGGAGATGTTAA
AAAGGCAATTCTCATAGGAACGTTGATTCCTCTTGTTCTCTATGTCTTAT
GGGAAGTTGTGGTTTTAGGTGCTGTCTCTCTTCCGATTCTTTCCCAGGCT
AAGATAGGTGGATATACTGCTGTAGAAGCTCTCAAGCAGGCCCATCGTTC
TTGGGCATTTTATATTGCTGGAGAACTTTTTGGCTTCTTTGCTTTGGTCT
CCTCTTTTGTAGGAGTTGCTCTCGGTGTTATGGACTTCCTGGCAGACGGT
TTAAAATGGAATAAAAAATCACATCCATTTTCAATTTTCTTTTTAACATT
TATTATTCCCCTTGCTTGGGCTGTTTGTTATCCTGAAATTGTTTTAACCT
GTCTTAAGTATGCTGGGGGATTCGGGGCCGCCGTGATTATCGGGGTATTC
CCAACATTGATTGTGTGGAAAGGGCGTTATGGCAAACAACATCACAGAGA
GAAACAGTTAGTTCCAGGAGGAAAGTTTGCTTTATTTTTGATGTTCTTGT
TGATAGTAATAAATGTAGTTAGCATTTATCATGAGCTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy