Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR771 IGR776 IGR769 IGR775 IGR773 IGR774 IGR772 IGR770 ftsY, - CPn0972 pcnB_2, - CPn0966 lpxB, - CPn0965 CPn0969.1 yccA_2, - CPn0971 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 ftsY, - CPn0972 pcnB_2, - CPn0966 lpxB, - CPn0965 CPn0969.1 yccA_2, - CPn0971 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968 Type: direct, Name:  - 15 Type: direct, Name:  - 21 Type: direct, Name:  - 15 Type: direct, Name:  - 20 Type: direct, Name:  - 12 Type: direct, Name:  - 20 Type: direct, Name:  - 17 Type: direct, Name:  - 12 Type: direct, Name:  - 21 Type: direct, Name:  - 17 ftsY, - CPn0972 pcnB_2, - CPn0966 lpxB, - CPn0965 CPn0969.1 yccA_2, - CPn0971 tyrP_2, - CPn0970 tyrP_1, - CPn0969 mrsA, - CPn0967 glmS, - CPn0968
* Calculated from Protein Sequence

Gene ID: CPn0968

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glmS  

Definition:
glucosamine-fructose-6-phosphate aminotransferase

Gene Start:
1109895

Gene Stop:
1111724

Gene Length:
1830

Molecular Weight*:
67181

pI*:
5.60

Net Charge*:
-17.31

EC:
2.6.1.16  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Aminosugars metabolism
Glutamate metabolism

Comment:
This enzyme catalyzes the addition of glutamine to D-fructose-6-phosphate.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to glucosamine-fructose-6-phosphate aminotransferase sequences; e.g. residues 1-609 are 61% similar to CT816, a predicted glucosamine-fructose-6-phosphate aminotransferase sequence; residues 1-609 are 36% similar to TP0861, a predicted glucosamine-fructose-6-phosphate aminotransferase sequence; residues 1-609 are 40% similar to GLMS_THETH; residues 1-609 are 40% similar to GLMS_ECOLI; and residues 1-609 are 40% similar to (AE000683) glucosamine-fructose-6-phosphate aminotransferase [Aquifex aeolicus].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 24-33, 74-87, 97-110, and 250-259 represent blocks BL00443A-E (Glutamine amidotransferases class-II proteins) with a combined E-value of 7.8e-16.

ProDom Summary:  Protein Domain Search
Residues 176-330 are 35% similar to a defined domain of O68956_MYCSM, defined as: AMINOTRANSFERASE AMIDOTRANSFERASE ISOMERIZING GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE GFAT TRANSFERASE HEXOSEPHOSPHATE D-FRUCTOSE-6- PHOSPHATE PROTEIN.
Residues 399-518 are 45% similar to a defined domain of GLMS_HAEIN, defined as: AMINOTRANSFERASE AMIDOTRANSFERASE GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE ISOMERIZING TRANSFERASE GFAT HEXOSEPHOSPHATE D-FRUCTOSE-6- PHOSPHATE PROTEIN.
Residues 81-174 are 42% similar to a defined domain of GLMS_ECOLI, defined as: ASPARAGINE SYNTHETASE AMIDOTRANSFERASE AMINOTRANSFERASE GLUTAMINE TRANSFERASE BIOSYNTHESIS LIGASE [GLUTAMINE-HYDROLYZING] PROTEIN.

Paralogs:  Local Blast Search
CPn0969.1, a predicted transport permease (truncated), is a probable paralog: residues 578-609 are 90% similar to CPn0969.1.

Pfam Summary:  Pfam Search
Residues 2 to 135 (E-value = 9.2e-47) place CPn0968 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)
Residues 287 to 422 (E-value = 1.8e-28) place CPn0968 in the SIS family which is described as SIS domain (PF01380)
Residues 459 to 595 (E-value = 8.5e-16) place CPn0968 in the SIS family which is described as SIS domain (PF01380)

PDB Hit:


Gene Protein Sequence:
MCGIFGYLGNQDGVSIVLEGLAKLEYRGYDSAGLAAVVEQELFIRKTVGR
VQELSNLFQEREIPTASVIGHTRWATHGVPTEINAHPHVDEGRSCAVVHN
GIIENFKELRRELTAQGISFASDTDSEIIVQLFSLYYQESQDLVFSFCQT
LAQLRGSVACALIHKDHPHTILCASQESPLILGLGKEETFIASDSRAFFK
YTRHSQALASGEFAIVSQGKEPEVYNLELKKIHKDVRQITCSEDASDKSG
YGYYMLKEIYDQPEVLEGLIQKHMDEEGHILSEFLSDVPIKSFKEITIVA
CGSSYHAGYLAKYIIESLVSTPVHIEVASEFRYRRPYIGKDTLGILISQS
GETADTLAALKELRRRNIAYLLGICNVPESAIALGVDHCLFLEAGVEIGV
ATTKAFTSQLLLLVFLGLKLANVHGALTHAEQCSFGQGLQSLPDLCQKLL
ANESLHSWAQPYSYEDKFLFLGRRLMYPVVMEAALKLKEIAYIEANAYPG
GEMKHGPIALISKGTPVIAFCGDDIVYEKMIGNMMEVKARHAHVIAIAPE
SREDIAAVSDQQIFVPDCHFLAAPVLYTIVGQVMAYAMALAKGMEIDCPR
NLAKSVTVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGCGGGATATTTGGATATTTGGGAAACCAAGATGGTGTGTCTATTGT
TCTAGAAGGCTTGGCAAAGTTAGAATATCGTGGTTATGATTCCGCAGGTC
TTGCTGCTGTAGTTGAACAAGAGCTTTTTATTAGAAAAACTGTAGGTCGT
GTTCAAGAGCTTTCAAACTTGTTTCAAGAAAGAGAAATCCCTACGGCATC
AGTTATTGGCCATACCCGTTGGGCAACTCATGGAGTGCCTACCGAGATTA
ATGCTCATCCACATGTGGATGAGGGAAGGTCGTGTGCTGTAGTCCATAAT
GGAATTATAGAAAATTTCAAAGAGTTGCGACGCGAGCTGACTGCGCAAGG
CATTTCATTTGCTTCAGATACCGATTCAGAAATTATTGTTCAGCTGTTTT
CTCTATATTATCAAGAGTCCCAAGATCTTGTGTTCAGCTTTTGTCAGACT
CTAGCTCAACTCCGAGGTAGCGTAGCCTGCGCTTTGATTCATAAAGATCA
TCCTCATACGATTCTTTGCGCTTCTCAAGAGAGCCCTTTAATTCTTGGTT
TAGGGAAAGAAGAGACGTTTATTGCTTCAGATTCGCGAGCTTTCTTCAAA
TATACTCGACATTCTCAAGCCTTGGCCTCCGGAGAATTTGCTATAGTTTC
TCAAGGGAAAGAACCTGAGGTTTATAATTTGGAGCTTAAGAAAATCCATA
AGGATGTACGACAAATCACCTGTAGTGAAGATGCTTCGGATAAAAGTGGC
TACGGCTATTATATGCTGAAGGAAATCTATGATCAGCCAGAAGTTTTAGA
AGGTCTGATTCAAAAACATATGGATGAAGAAGGACATATTTTATCTGAAT
TTTTATCAGATGTTCCTATCAAGAGTTTTAAAGAAATCACGATTGTTGCT
TGCGGGTCTTCCTATCATGCTGGTTATCTCGCTAAATATATTATAGAGTC
CTTAGTTTCAACTCCTGTACATATTGAAGTGGCTTCCGAATTTCGCTATC
GACGTCCCTACATAGGTAAAGATACTTTGGGGATTTTGATCAGTCAATCA
GGAGAAACAGCTGATACCCTAGCTGCTTTGAAGGAATTACGTCGCAGAAA
CATTGCTTATCTCCTAGGCATTTGCAATGTCCCGGAATCAGCAATTGCTC
TTGGTGTGGATCACTGTCTGTTTTTAGAAGCGGGGGTGGAAATCGGTGTA
GCTACGACAAAGGCTTTTACCTCGCAACTCTTGTTGCTTGTGTTTTTGGG
TTTGAAATTAGCAAATGTACATGGTGCCTTGACTCACGCAGAACAATGTT
CCTTTGGCCAGGGATTACAAAGCTTACCAGATCTCTGTCAAAAACTTCTT
GCCAACGAGTCTCTCCATTCTTGGGCGCAGCCTTACTCCTATGAAGATAA
GTTTCTTTTTCTAGGCCGTAGGTTGATGTATCCGGTGGTTATGGAGGCTG
CCCTCAAACTCAAAGAAATTGCTTATATTGAAGCGAATGCGTATCCTGGT
GGAGAAATGAAACATGGGCCCATAGCTTTAATTAGCAAAGGTACCCCTGT
TATTGCATTTTGCGGTGATGATATTGTCTATGAAAAGATGATAGGCAACA
TGATGGAGGTTAAAGCTCGTCATGCTCATGTGATTGCTATTGCTCCTGAA
TCTCGTGAAGATATCGCTGCAGTTTCTGATCAACAGATCTTTGTCCCAGA
TTGTCATTTTCTCGCTGCTCCTGTGTTATATACTATAGTTGGTCAAGTGA
TGGCATATGCTATGGCGTTAGCAAAAGGAATGGAGATTGACTGTCCCAGA
AATCTTGCCAAGTCTGTTACTGTAGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy