Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_His_1 rRNA-16SrRNA_1 IGR699 IGR698 IGR697 IGR693 IGR694 IGR696 IGR695 IGR700 CPn0879 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 CPn0874 ftsK, - CPn0880 CPn0878 CPn0878 ybcL, - CPn0877 CPn0875 ribA, - CPn0872 dagA_2, - CPn0876 CPn0873
* Calculated from Protein Sequence

Gene ID: CPn0877

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ybcL  

Definition:
conserved hypothetical protein, YbcL family (acidic)

Gene Start:
995533

Gene Stop:
995985

Gene Length:
453

Molecular Weight*:
16617

pI*:
4.30

Net Charge*:
-10.37

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0877 is orthologous to CT736, a conserved hypothetical protein (acidic):
residues 1-149 are 71% similar to CT736. No similarity to T.pallidum, M.genitalium,
or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG1881
COG name: Uncharacterized ACR, YbhB family
Functional Class:  S
The phylogenetic pattern of COG1881 is a-tkYq--EbR-uj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 150 (E-value = 4.2e-60) place CPn0877 in the PBP family which is described as Phosphatidylethanolamine-binding protein (PF01161)

PDB Hit:


Gene Protein Sequence:
MQLLSPAFAYGAPIPKKYTCQGAGISPPLTFVDVPGAAQSLALIVEDPDV
PKEIRSDGLWIHWIVYNLSTTITNLAEGAEIFAVQGLNTSGKPVYEGPCP
PDKQHRYFFTLFALDVVLPEEENVTRDQLYEAMEFHIIEQAELMGTYEKS
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTATTGTCCCCAGCGTTTGCTTATGGCGCCCCAATTCCTAAGAA
GTATACATGCCAAGGCGCAGGGATTTCCCCTCCCTTGACTTTTGTAGACG
TCCCCGGTGCAGCGCAAAGTCTTGCTTTGATTGTCGAAGACCCTGATGTT
CCTAAAGAAATTCGTAGCGATGGCCTGTGGATCCACTGGATAGTCTATAA
CCTATCCACCACAATTACTAATCTTGCCGAAGGAGCTGAAATCTTCGCTG
TGCAAGGATTAAATACTTCTGGAAAGCCTGTCTATGAAGGTCCCTGTCCT
CCAGATAAACAGCACCGCTACTTCTTTACTCTATTTGCTCTTGACGTAGT
TCTTCCAGAAGAAGAAAACGTCACCCGTGATCAGCTATATGAAGCAATGG
AATTCCATATTATAGAACAAGCAGAGTTAATGGGAACTTACGAGAAAAGT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy