Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR699 IGR698 IGR697 IGR693 IGR694 IGR692 IGR696 IGR695 CPn0879 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 CPn0874 ftsK, - CPn0880 CPn0878 CPn0878 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876
* Calculated from Protein Sequence

Gene ID: CPn0876

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dagA_2  

Definition:
D-alanine/glycine permease

Gene Start:
994144

Gene Stop:
995520

Gene Length:
1377

Molecular Weight*:
48261

pI*:
8.90

Net Charge*:
12.76

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to D-alanine glycine permease sequences; e.g. residues 1-454 are 63% similar to CT735, a predicted D-alanine glycine permease; residues 2-450 are 27% similar to CT409, a predicted sodium dependant D-alanine glycine permease; residues 18-430 are 27% similar to TP0414, a predicted D-alanine glycine permease; residues 14-438 are 26% similar to TP0998, a predicted amino acid transporter; residues 19-437 are26% similar to (AE000603) D-alanine glycine permease (dagA) [Helicobacter pylori 26695]; and residues 1-445 are 26% similar to (Z99118) similar to sodium/proton-dependent alanine carrier protein [Bacillus subtilis].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1115
COG name: Sodium-alanine symporters
Functional Class:  E
The phylogenetic pattern of COG1115 is ---k----eB-Huj---LIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 63-446 span five regions of similarity to blocks BL00873A-E (Sodium:alanine symporter family proteins) with a combined E-value of 2.5e-37.

ProDom Summary:  Protein Domain Search
Residues 183-438 are 30% similar to a defined domain of Y883_HAEIN, defined as: TRANSPORT PROTEIN TRANSMEMBRANE SYMPORT AMINO-ACID SODIUM INNER MEMBRANE D-ALANINE GLYCINE.
Residues 53-171 are 33% similar to a defined domain of O25596_XXXXX, defined as: TRANSPORT PROTEIN TRANSMEMBRANE AMINO-ACID PERMEASE ACID AMINO INNER MEMBRANE COTRANSPORTER.

Paralogs:  Local Blast Search
One possible paralog found in C.pneumoniae. Residues 14-441 are 27% similar to CPn0536, a predicted D-ALa/GLy Permease.

Pfam Summary:  Pfam Search
Residues 44 to 447 (E-value = 4.7e-25) place CPn0876 in the Na_Ala_symp family which is described as Sodium:alanine symporter family (PF01235)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
32
transmembrane  
69  
86
transmembrane  
91  
110
transmembrane  
138  
162
transmembrane  
182  
199
transmembrane  
210  
234
transmembrane  
239  
256
transmembrane  
303  
324
transmembrane  
345  
364
transmembrane  
387  
404
transmembrane  
414  
431

PDB Hit:


Gene Protein Sequence:
MLYFIEQLNKLSTSFCVFPMILLLGGFLTWKLRGLQFHGLKLGFNLMLQN
KLDDSSSKANEVSSYEAVAGILAGNFGTGNIAGMAVALACGGPGALVWVW
LAALLGAIVQYAGSYLGSKYRKPEGNTGEFIGGPIACLAFGMRKKILAGF
FALFTIMTAFCAGNCVQVSCIVPLCAEGTPGKLLVGILLALVVIPVLAGG
NNRILRFSARVIPFIAGFYCISCGIILFQHASAILPAIKLICSSAFGIKA
GLAGIGGYTLSQVISTGINRAVMATDCGSGMVSILQANTKSKNPVVDGLV
TLVPPVIVMVVCSITMLVLIVSGAYSSGAQGTLMVMSAFKNSLGSLGSVI
VILAMALFGYTTILTWFACAEKSLQYMIPGRRANLWLKAIYVLIIPLGGV
IDMRMIWALSDTGFSGMVILNCIALIALLKDVLSTNRDVALLKERECSVA
DPVRNLDA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATATTTTATAGAACAGCTAAATAAACTGAGTACGTCGTTTTGTGT
ATTCCCTATGATCTTATTGTTAGGGGGGTTCTTGACATGGAAATTACGCG
GTTTACAGTTCCACGGGTTAAAGCTCGGCTTTAACTTGATGCTTCAAAAT
AAATTGGATGATAGTTCATCAAAAGCTAACGAAGTTTCTTCGTACGAAGC
TGTAGCCGGAATCCTAGCAGGAAATTTTGGCACGGGAAATATCGCCGGAA
TGGCTGTCGCCTTAGCTTGTGGAGGTCCAGGCGCCCTGGTCTGGGTCTGG
CTTGCAGCCCTCCTCGGAGCTATCGTCCAATATGCTGGCTCCTATTTAGG
TTCAAAATATAGGAAACCTGAAGGAAATACAGGAGAATTTATAGGAGGAC
CCATAGCCTGCCTCGCTTTTGGCATGCGTAAAAAAATACTCGCAGGATTC
TTTGCTTTATTCACTATCATGACAGCCTTCTGTGCAGGAAACTGTGTTCA
GGTAAGTTGTATCGTTCCTCTCTGTGCAGAAGGAACTCCAGGAAAACTCC
TCGTTGGAATTCTACTAGCTCTCGTAGTGATCCCCGTGTTAGCAGGAGGA
AATAACCGTATATTAAGATTCTCTGCTCGTGTGATTCCCTTCATAGCAGG
ATTTTACTGTATTTCTTGCGGGATCATTCTCTTCCAACATGCCTCGGCTA
TTCTTCCCGCAATCAAACTGATATGCTCTTCAGCATTCGGCATTAAAGCC
GGACTCGCTGGAATCGGAGGCTATACTCTTTCGCAAGTCATCTCTACAGG
GATTAACCGTGCTGTCATGGCTACAGATTGCGGCAGCGGAATGGTATCTA
TTTTGCAAGCAAATACAAAAAGCAAAAATCCTGTTGTAGACGGACTCGTT
ACTCTAGTCCCCCCAGTCATTGTGATGGTTGTTTGCTCTATTACAATGCT
CGTTCTAATTGTCTCAGGAGCTTACAGCTCAGGAGCCCAAGGAACTCTAA
TGGTCATGAGTGCCTTTAAAAATAGCCTCGGCTCTCTAGGTAGTGTGATT
GTTATTCTCGCTATGGCCCTATTCGGATATACAACAATATTGACATGGTT
TGCTTGCGCAGAAAAAAGTTTACAATATATGATCCCAGGAAGACGAGCAA
ATCTATGGTTGAAGGCTATATACGTCTTGATCATTCCTCTAGGGGGTGTT
ATCGATATGCGTATGATTTGGGCCTTATCTGACACAGGTTTTTCTGGTAT
GGTCATTCTGAACTGCATAGCTCTAATCGCCTTACTGAAAGATGTACTAT
CCACAAACCGCGATGTTGCTTTGCTTAAAGAACGCGAGTGCTCTGTTGCA
GATCCTGTGCGTAATCTAGATGCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy