Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR699 IGR698 IGR697 IGR693 IGR691 IGR694 IGR692 IGR696 IGR695 CPn0879 serS, - CPn0870 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 serS, - CPn0870 CPn0874 ftsK, - CPn0880 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0879 serS, - CPn0870 CPn0874 ftsK, - CPn0880 CPn0878 CPn0878 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876
* Calculated from Protein Sequence

Gene ID: CPn0875

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
993372

Gene Stop:
994025

Gene Length:
654

Molecular Weight*:
24471

pI*:
6.10

Net Charge*:
-0.84

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT734, a hypothetical protein. Residues 1-216 are 57% similar to CT734.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23
coil-coil  
29  
81

PDB Hit:


Gene Protein Sequence:
MKRVIYKTIFCGLTLLTSLSSCSLDPKGYNLETKNSRDLNQESVILKENR
ETPSLVKRLSRRSRRLFARRDQTQKDTLQVQANFKTYAEKISEQDERDLS
FVVSSAAEKSSISLALSQGEIKDALYRIREVHPLALIEALAENPALIEGM
KKMQGRDWIWNLFLTQLSEVFSQAWSQGVISEEDIAAFASTLGLDSGTVA
SIVQGERWPELVDIVIT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAGTCATTTATAAAACCATATTTTGCGGGTTAACTTTACTTAC
AAGTTTGAGTAGTTGTTCCCTGGATCCTAAAGGATATAACCTAGAGACAA
AAAACTCGAGGGACTTAAATCAAGAGTCTGTTATACTGAAGGAAAACCGT
GAAACACCTTCTCTTGTTAAGAGACTCTCTCGTCGTTCTCGAAGACTCTT
CGCTCGACGTGATCAAACTCAGAAGGATACGCTGCAAGTGCAAGCTAACT
TTAAGACCTACGCAGAAAAGATTTCAGAGCAGGACGAAAGAGACCTTTCT
TTCGTTGTCTCGTCTGCTGCAGAAAAGTCTTCAATTTCGTTAGCTTTGTC
TCAGGGTGAAATTAAGGATGCTTTGTACCGTATCCGAGAAGTCCACCCTC
TAGCTTTAATAGAAGCTCTTGCTGAAAACCCTGCCTTGATAGAAGGGATG
AAAAAGATGCAAGGCCGTGATTGGATTTGGAATCTTTTCTTAACACAATT
AAGTGAAGTATTTTCTCAAGCTTGGTCTCAAGGGGTTATCTCTGAAGAAG
ATATCGCCGCATTTGCCTCCACCTTAGGTTTGGACTCCGGGACCGTTGCG
TCCATTGTCCAAGGGGAAAGGTGGCCCGAGCTTGTGGATATAGTGATAAC
TTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy