Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR698 IGR689 IGR697 IGR693 IGR691 IGR690 IGR694 IGR692 IGR696 IGR695 CPn0878 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0878 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0878 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0869 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876
* Calculated from Protein Sequence

Gene ID: CPn0873

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
riboflavin synthase subunit beta

Gene Start:
991233

Gene Stop:
991697

Gene Length:
465

Molecular Weight*:
16324

pI*:
7.80

Net Charge*:
1.52

EC:
2.5.1.9  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; riboflavin  

Pathway: pathway table
Riboflavin metabolism

Comment:
This protein is involved in the final step of riboflavin biosynthesis.
In HAEIN, the oligomer is said to consist of three alpha and 60 beta chains.

Blast Summary:  PSI-Blast Search
CPn0873 is orthologous to CT732, a predicted riboflavin synthase beta chain:
residues 1-154 are 63% similar to CT732. No similarity to T.pallidum, M.genitalium,
or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0054
COG name: Riboflavin synthase beta-chain
Functional Class: H
The phylogenetic pattern of COG0054 is amt-yqvcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 10 to 154 (E-value = 4e-28) place CPn0873 in the DMRL_synthase family which is described as 6,7-dimethyl-8-ribityllumazine synthase (PF00885)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
103  
121

PDB Hit:


Gene Protein Sequence:
MKTLKGHLSAKNLRIAIVGSCFNQAMADALVSGTQETFLKFGGSEDGLMT
IRVPGAFEIPCTIKKLLSSERKFDAIVACGVLIQGETDHYNQIVNQVAAG
IGALSLEFCLPITLSIVAAPSAEIAWQRSGIKGRHLGVSGMTTAIEMATL
FTQI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACATTGAAAGGACATTTGTCTGCAAAGAATCTACGTATTGCTAT
TGTCGGCTCCTGCTTTAATCAAGCTATGGCTGATGCCCTAGTTTCTGGTA
CTCAGGAAACTTTTTTGAAGTTTGGAGGGAGCGAGGACGGCTTGATGACT
ATCCGTGTTCCCGGAGCTTTTGAGATTCCCTGTACGATCAAAAAACTTTT
ATCTTCTGAAAGAAAGTTCGATGCTATTGTTGCATGCGGCGTCCTAATTC
AAGGAGAAACAGACCATTATAACCAAATTGTAAATCAAGTAGCGGCAGGT
ATTGGTGCTCTCTCTTTGGAATTTTGTCTTCCCATAACCTTGTCCATAGT
TGCAGCTCCTTCTGCAGAAATCGCTTGGCAAAGATCAGGTATTAAAGGAC
GTCATTTGGGAGTTTCTGGGATGACGACAGCTATAGAAATGGCAACGTTA
TTCACTCAAATCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy