Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR697 IGR693 IGR691 IGR690 IGR694 IGR692 IGR696 IGR695 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 ybcL, - CPn0877 CPn0873 CPn0875 ribD, - CPn0871 ribA, - CPn0872 dagA_2, - CPn0876
* Calculated from Protein Sequence

Gene ID: CPn0872

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribA  

Definition:
GTP cyclohydrolase II /3,4-dihydroxy-2-butanone-4-phoshate synthase

Gene Start:
989963

Gene Stop:
991219

Gene Length:
1257

Molecular Weight*:
45834

pI*:
6.50

Net Charge*:
-3.46

EC:
3.5.4.25  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; riboflavin  

Pathway: pathway table
Riboflavin metabolism

Comment:
Forms 2,5-DIAMINO-6-HYDROXY-4-(5-PHOSPHORIBOSYLAMINO)PYRIMIDINE as part of
riboflavin biosynthesis.

Blast Summary:  PSI-Blast Search
CPn0872 is orthologous to CT731, a predicted GTP cyclohydrolase II/3,4-dihydroxy-2-butanone-4-phoshate synthase:
residues 11-411 are 66% similar to CT731. No similarity to T.pallidum, M.genitalium or U. urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0108
COG name: 3,4-dihydroxy-2-butanone 4-phosphate synthase
Functional Class:  H
The phylogenetic pattern of COG0108 is Amt-yqvcebRhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 16 to 211 (E-value = 2.1e-96) place CPn0872 in the DHBP_synthase family which is described as 3,4-dihydroxy-2-butanone 4-phosphate synthase (PF00926)
Residues 214 to 385 (E-value = 5.6e-101) place CPn0872 in the GTP_cyclohydro2 family which is described as GTP cyclohydrolase II (PF00925)

PDB Hit:


Gene Protein Sequence:
MIETREEVGSANFVSLERAIEDLRAGKFVIVVDEASREDEGDLIIAGEKI
TVEKMTFLLQHTTGVVCAALSQERLLSLDLPPMVKDNRCRFKTPFTVSVD
AAHGVTTGVSAADRTKVVQLLADPKSKPEDFISPGHFFPLASSPGGVLKR
AGHTESTVDLMELAGLQPCGVLAELVNEDYSMMRLPQILEFARKHNIAVI
PVTSIIAHRMLSDRLVSKISSARLPTIYGDFTIHVYESLLEGMQHLALVK
GNVAGKSNVLVRVHSECVTGDILGSKRCDCGEQLSSAMSYIAEKGTGVLV
YLRGQEGRGIGLGHKVRAYALQDNGYDTVDANLAMGFPVDSREYGIGAQI
LVDLKLTTIKLITHNPQKYFGLQGFGLSITERVPLPVRISEDNEQYLRTK
QERMGHWLDLPCCNNRVQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATAGAAACTCGAGAAGAGGTAGGCTCTGCAAATTTTGTTTCTTTAGA
ACGAGCTATTGAGGATTTAAGAGCAGGAAAATTTGTTATTGTTGTTGATG
AAGCTTCGAGAGAAGATGAAGGCGACCTGATTATCGCGGGAGAAAAAATT
ACAGTTGAAAAGATGACGTTTCTTCTCCAGCACACCACAGGAGTGGTTTG
CGCTGCTTTAAGCCAAGAACGTCTCTTAAGCTTGGATCTTCCTCCCATGG
TTAAGGATAACCGTTGCCGTTTTAAAACTCCCTTCACTGTATCCGTAGAT
GCTGCTCACGGGGTGACTACAGGAGTTTCTGCCGCAGATAGAACCAAAGT
CGTTCAGTTATTAGCAGATCCTAAGAGCAAACCCGAAGATTTTATTAGCC
CAGGACACTTTTTCCCCCTAGCAAGTTCTCCAGGAGGAGTGTTAAAACGA
GCAGGTCATACAGAATCTACTGTTGACCTAATGGAGTTGGCAGGACTGCA
GCCTTGTGGTGTACTCGCAGAATTAGTGAACGAAGACTACTCTATGATGC
GATTGCCTCAAATTTTAGAGTTCGCAAGGAAACATAATATTGCAGTGATT
CCCGTGACATCGATCATTGCTCATCGCATGCTCTCCGATCGTTTGGTTTC
TAAAATCTCTTCAGCACGCCTCCCTACAATTTACGGAGACTTTACGATTC
ATGTCTATGAATCCTTATTGGAAGGAATGCAACATCTTGCTTTGGTAAAA
GGCAATGTTGCTGGAAAAAGTAATGTCCTCGTACGTGTCCACTCAGAGTG
TGTCACAGGAGATATTTTAGGATCTAAGCGCTGTGATTGTGGAGAACAAT
TGAGTTCAGCAATGTCCTACATTGCTGAGAAGGGAACTGGTGTTCTTGTT
TACTTGCGAGGGCAGGAAGGCCGAGGGATCGGTTTGGGCCATAAAGTACG
TGCTTATGCTTTGCAAGATAACGGTTATGATACTGTAGATGCAAACTTAG
CTATGGGATTTCCCGTAGACTCAAGGGAATATGGCATAGGAGCACAAATT
CTTGTTGATCTCAAGTTGACAACCATAAAATTAATCACTCATAATCCTCA
AAAATATTTTGGGCTTCAAGGTTTCGGACTTAGCATCACAGAAAGAGTTC
CTCTTCCTGTTCGCATTTCTGAAGACAATGAGCAGTATTTAAGAACAAAA
CAGGAACGTATGGGACATTGGCTAGATCTCCCATGCTGTAACAATCGGGT
ACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy