Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR693 IGR691 IGR690 IGR694 IGR692 IGR696 IGR695 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 CPn0875 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 dagA_2, - CPn0876 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 CPn0875 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 dagA_2, - CPn0876 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 dagA_2, - CPn0876 CPn0875
* Calculated from Protein Sequence

Gene ID: CPn0871

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ribD  

Definition:
riboflavin-specific deaminase

Gene Start:
988772

Gene Stop:
989902

Gene Length:
1131

Molecular Weight*:
41197

pI*:
6.90

Net Charge*:
-0.34

EC:
3.5.4.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; riboflavin  

Pathway: pathway table

Comment:
Catalyzes formation of 5-AMINO-6-(RIBOSYLAMINO)-2,4(1H,3H)-PYRIMIDINEDIONE
5'-PHOSPHATE.

Blast Summary:  PSI-Blast Search
CPn0871 is orthologous to CT730, a predicted riboflavin-specific deaminase:
residues 1-369 are 53% similar to CT730. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1985
COG name: Pyrimidine reductase, riboflavin biosynthesis
Functional Class:  H
The phylogenetic pattern of COG1985 is amt-yQvcebRhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 105 (E-value = 8.2e-30) place CPn0871 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)
Residues 152 to 362 (E-value = 7.8e-68) place CPn0871 in the RibD_C family which is described as RibD C-terminal domain (PF01872)

PDB Hit:


Gene Protein Sequence:
MEDFSEQQLFFMRRAIEIGEKGRITAPPNPWVGCVVVQENRIIGEGFHAY
AGGPHAEELAIQNASMPISGSDVYVSLEPCSHFGSCPPCANLLIKHKVSR
VFVALVDPDPKVAGQGIAMLRQAGIQVYVGIGESEAQASLQPYLYQRTHN
FPWTILKSAASVDGQVADSQGKSQWITCPEARHDVGKLRAESQAILVGSR
TVLSDDPWLTARQPQGMLYPKQPLRVVLDSRGSVPPTSKVFDKTSPTLYV
TTERCPENYIKVLDSLDVPVLLTESTPSGVDLHKVYEYLAQKKILQVLVE
GGTTLHTSLLKERFVNSLVLYSGPMILGDQKRPLVGVLGNLLESASPLTL
KSSQILGNSLKVVWEISPQVFEPIRN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGATTTCTCTGAGCAACAACTCTTTTTTATGCGGCGTGCTATAGA
AATCGGAGAAAAGGGTAGAATCACAGCCCCCCCAAATCCTTGGGTAGGGT
GTGTGGTCGTTCAAGAAAATCGCATCATAGGGGAGGGATTTCATGCGTAT
GCTGGAGGACCCCACGCTGAAGAGCTCGCCATACAAAACGCCTCTATGCC
TATATCAGGATCCGATGTCTATGTTTCTCTAGAGCCTTGCTCTCATTTTG
GGTCATGCCCCCCATGTGCGAACTTACTAATCAAACATAAGGTCTCTAGA
GTTTTTGTTGCTCTTGTTGATCCTGATCCCAAAGTCGCAGGTCAAGGAAT
CGCCATGCTACGTCAGGCAGGGATTCAGGTCTATGTCGGTATTGGAGAGA
GCGAAGCACAGGCGTCTCTACAGCCGTATCTATACCAAAGGACCCACAAC
TTCCCTTGGACAATATTGAAAAGTGCCGCAAGTGTTGATGGTCAAGTTGC
CGATTCTCAAGGGAAGTCTCAATGGATTACTTGTCCAGAGGCTCGTCATG
ATGTGGGAAAATTGCGAGCAGAGTCCCAAGCCATTCTTGTCGGTTCTCGT
ACGGTTCTTAGTGACGATCCGTGGCTCACAGCAAGACAACCTCAGGGAAT
GCTCTATCCCAAACAGCCTCTACGTGTCGTCTTAGACAGTCGTGGGAGCG
TCCCTCCTACATCAAAAGTCTTTGATAAGACCAGTCCGACTCTGTATGTA
ACCACAGAACGATGTCCTGAAAATTATATAAAAGTTTTAGATTCCTTAGA
CGTCCCCGTTTTACTCACAGAATCTACCCCATCAGGAGTGGATCTTCACA
AGGTCTATGAGTATCTTGCTCAAAAAAAGATACTACAGGTTCTTGTAGAA
GGAGGCACCACACTACATACGTCTTTGCTAAAAGAAAGATTTGTTAATTC
TTTGGTTCTTTACTCTGGGCCTATGATTCTTGGGGACCAAAAGAGACCTC
TAGTCGGAGTATTAGGAAATTTGTTGGAATCTGCCTCTCCTCTAACTCTG
AAAAGTTCCCAAATTTTAGGAAATTCTTTGAAGGTCGTATGGGAGATTTC
CCCTCAGGTTTTCGAGCCCATAAGGAATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy