Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR693 IGR691 IGR690 IGR694 IGR692 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872
* Calculated from Protein Sequence

Gene ID: CPn0870

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serS  

Definition:
seryl-tRNA synthetase

Gene Start:
988728

Gene Stop:
987445

Gene Length:
1284

Molecular Weight*:
48219

pI*:
5.70

Net Charge*:
-7.74

EC:
6.1.1.11  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Seryl-tRNA synthetase is a cytoplasmically located homodimer which
belongs to class-II aminoacyl-tRNA synthetases.

Reaction: ATP + l-serine + tRNA(ser) = AMP + pyrophosphate +
l-seryl-tRNA(ser).

Blast Summary:  PSI-Blast Search
CPn0870 is orthologously related to CT729: residues 1-425 of CPn0870 are 74% similar to residues 1-425 of CT729, a predicted seryl-tRNA synthetase from C. trachomatis.
CPn0870 is also similar to UU106, TP0647, MG005.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0172
COG name: Seryl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0172 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 107 (E-value = 2.1e-37) place CPn0870 in the Seryl_tRNA_N family which is described as Seryl-tRNA synthetase N-terminal domain (PF02403)
Residues 161 to 317 (E-value = 2.5e-56) place CPn0870 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
30  
102

PDB Hit:


Gene Protein Sequence:
MLDIKIIRKTPEECETRLRKKDPKISLEPVLSLDKEVRQLKTDSETLQAQ
RRLLSQDIHKAKTQGVDATNLIQEVETLAADLEKIEQHLDQKNAQLHELL
SHLPNYPADDIPVSEDKAGNQVIKSVGDLPIFSFPPKHHLELNQELDILD
FQAAAKTTGSGWPAYKNRGVLLEWALLTYMLQKQAAHGFQLWLPPLLVKK
EILFGSGQIPKFDGQYYRVEDGEQYLYLIPTAEVVLNGFRSQDILTEKEL
PLYYAACTPCFRREAGAAGAQERGLVRVHQFHKVEMFAFTTPNQDDIAYE
KMLSIVEEMLTELKLPYRLSLLSTGDMSFTASKTIDAEVWLPGQKAFYEV
SSISQCTDFQSRRSGTRYKDSQGKLQFVHTLNGSGLATPRLLVAILENNQ
QADGSVVIPEVLRPYLGGLEILLPKDQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGGATATAAAAATTATACGCAAGACTCCCGAAGAATGTGAAACTCG
ACTTCGTAAAAAAGATCCAAAAATTTCTTTAGAACCTGTACTCTCCTTGG
ATAAAGAGGTCCGTCAACTCAAGACGGATTCAGAAACTTTACAAGCACAA
AGACGCCTCTTATCTCAAGATATACATAAAGCTAAAACGCAAGGGGTAGA
CGCGACAAACTTAATTCAAGAGGTAGAGACTCTTGCTGCGGATCTTGAAA
AAATTGAGCAGCACCTCGATCAAAAAAACGCTCAACTACATGAATTGCTG
AGCCATCTTCCTAATTACCCTGCTGACGACATTCCTGTATCCGAGGACAA
AGCGGGAAATCAAGTCATTAAAAGTGTTGGGGACCTTCCTATATTTTCCT
TTCCTCCGAAGCATCACTTAGAGCTAAATCAGGAGTTAGACATCTTAGAT
TTCCAAGCAGCAGCAAAAACGACAGGATCAGGATGGCCTGCTTATAAAAA
TCGTGGTGTTCTTCTGGAATGGGCTCTTCTTACGTATATGTTACAGAAGC
AAGCAGCTCATGGATTTCAGCTCTGGCTTCCCCCCTTATTAGTGAAGAAA
GAAATTTTATTTGGCTCTGGGCAGATTCCGAAATTTGATGGACAATACTA
TCGTGTTGAGGACGGAGAGCAGTATCTCTATCTGATCCCCACTGCGGAAG
TCGTTCTTAATGGGTTTCGTTCCCAAGACATTTTAACAGAAAAAGAACTT
CCTCTTTACTATGCTGCGTGCACTCCGTGCTTCCGAAGAGAAGCAGGTGC
TGCAGGAGCTCAAGAGAGAGGACTTGTGCGGGTGCATCAATTCCATAAGG
TAGAAATGTTTGCCTTTACAACACCCAATCAAGATGATATTGCTTATGAA
AAAATGCTTAGTATTGTTGAAGAAATGCTGACAGAGCTCAAGTTGCCTTA
TCGTCTTTCTTTGCTTTCTACGGGGGATATGTCTTTTACAGCATCCAAGA
CTATAGATGCTGAGGTCTGGTTGCCAGGACAAAAAGCTTTTTATGAAGTG
TCTTCTATTTCTCAGTGTACGGATTTCCAATCGCGGCGCTCTGGGACTCG
CTATAAAGATAGCCAAGGGAAACTACAGTTTGTTCATACTCTTAACGGTT
CAGGTCTGGCAACACCACGTCTCTTGGTAGCTATTTTAGAAAATAACCAA
CAAGCTGATGGCTCTGTGGTTATTCCTGAAGTCCTTCGTCCTTATTTAGG
AGGGTTGGAGATTCTTCTTCCCAAAGACCAGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy