Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR693 IGR688 IGR691 IGR690 IGR694 IGR692 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 serS, - CPn0870 CPn0874 cadA,zntA, - CPn0868 CPn0873 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 CPn0865
* Calculated from Protein Sequence

Gene ID: CPn0869

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
987401

Gene Stop:
986655

Gene Length:
747

Molecular Weight*:
28481

pI*:
7.80

Net Charge*:
3.17

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT728, a hypothetical protein. Residues 6-247 are 51% similar to CT728.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
46  
65
transmembrane  
70  
87
coil-coil  
102  
129
transmembrane  
182  
206
transmembrane  
227  
244

PDB Hit:


Gene Protein Sequence:
MTQDPHDHFKSRTPEDHIKHVRDKHRVCKGEPHTTFKGFFYHLANNALST
GVFIFFIRTLFFLIPTNRALQVKSLISLGVGWTFYHGCLKARKAWAYMEL
SHRSMLEEKNEIEENFEQEKIELRILFENQGFKDPLLQEMVEYVCSDSTL
LLDTMIREELYIRKEDLPHPLIQGGSRILGGLCGLAIFLPLVLCISYTLA
GVFSALMVLVLSFLKAKILKNDKISEMVWVLGIFITSASIISSLMKLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCAGGATCCACATGACCACTTTAAATCACGCACTCCAGAGGACCA
CATAAAGCATGTTAGAGACAAGCACAGAGTCTGTAAAGGGGAGCCCCATA
CAACCTTTAAAGGGTTTTTCTATCACTTAGCTAATAATGCTTTATCTACT
GGCGTTTTTATTTTTTTCATTCGGACGTTGTTTTTCTTAATTCCTACGAA
TCGTGCGCTTCAAGTAAAATCCTTAATATCTTTAGGCGTTGGCTGGACAT
TTTACCACGGATGCTTAAAAGCAAGAAAAGCTTGGGCCTATATGGAACTC
TCGCATCGTTCTATGCTGGAAGAGAAAAACGAGATTGAAGAGAATTTTGA
ACAAGAAAAAATAGAACTCCGGATTTTGTTTGAGAATCAAGGGTTTAAAG
ACCCTCTCCTCCAAGAGATGGTAGAATATGTCTGTTCCGATTCTACCCTA
CTACTAGATACGATGATTCGAGAAGAGCTTTACATTCGAAAAGAAGATCT
TCCTCATCCCCTGATTCAAGGAGGATCTAGAATATTAGGAGGTCTATGTG
GGCTTGCCATTTTCCTCCCACTAGTCCTATGCATCAGCTACACTCTTGCA
GGGGTCTTTTCTGCTCTTATGGTTCTGGTTCTTTCCTTCCTAAAAGCTAA
AATTCTAAAAAACGATAAAATTTCCGAAATGGTTTGGGTGTTAGGGATCT
TCATCACTTCCGCGAGTATTATCTCATCATTAATGAAATTATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy