Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR688 IGR691 IGR690 IGR692 IGR687 birA, - CPn0866 CPn0869 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872 birA, - CPn0866 CPn0869 serS, - CPn0870 cadA,zntA, - CPn0868 pgmA, - CPn0863 yfhO,nifS, - CPn0862 pgmA, - CPn0863 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 ribA, - CPn0872
* Calculated from Protein Sequence

Gene ID: CPn0868

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cadA  zntA  

Definition:
cation-transporting ATPase

Gene Start:
986643

Gene Stop:
984667

Gene Length:
1977

Molecular Weight*:
70753

pI*:
6.70

Net Charge*:
-2.26

EC:
3.6.1.-  

Functional Class:
transport and binding proteins; cations  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Comment:
An antiporter protein that is responsible for cation (perhaps specifically cadmium) efflux.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to cations-transporting ATPase sequences; e.g. residues 4-658 are 71% similar to CT727, a cation-transporting ATPase; residues 121-657 are 27% similar to UU203, a predicted copper/potassium transporting ATPase A; residues 120-655 are 27% similar to TP1036, a heavy metal-transporting ATPase/cation-transporting ATPase; residues 121-605 are 23% similar to MG071, a cation-transporting P-ATPase; residues 64-654 are 33% similar to (Z99707) Cu2+-transporting ATPase-like protein [Arabidopsis thaliana]; and residues 68-657 are 32% similar to CADA_LISMO.

COGS Summary:  COGS Search
BeTs to 12 clades of COG2217
COG name: Cation transport ATPases
Functional Class:  P
The phylogenetic pattern of COG2217 is AmT-YQvCEBRhUJ---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 175-608 span six regions of similarity to blocks BL00154A-G (E1-E2 ATPases phosphorylation site proteins) with a combined E-value of 7.1e-44.

ProDom Summary:  Protein Domain Search
Residues 221-437 are 35% similar to a defined domain of CADA_STAAU, defined as: ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION ATP-BINDING METAL-BINDING PROTEIN COPPER COPPER-TRANSPORTING P-TYPE.
Residues 576-656 are 50% similar to a defined domain of O22498_SOYBN, defined as: ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION ATP-BINDING TRANSPORT PUMP CALCIUM MEMBRANE MAGNESIUM.
Resdiues 90-210 are 35% similar to a defined domain of CADA_LISMO, defined as: ATPASE HYDROLASE TRANSMEMBRANE PHOSPHORYLATION ATP-BINDING TRANSPORT CALCIUM PUMP MAGNESIUM MEMBRANE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 121 to 346 (E-value = 1.4e-48) place CPn0868 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 350 to 575 (E-value = 5.7e-34) place CPn0868 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
12
transmembrane  
52  
76
transmembrane  
104  
128
transmembrane  
274  
292
transmembrane  
305  
327
transmembrane  
616  
640

PDB Hit:


Gene Protein Sequence:
VFSRLFFTSFSAEVVNTFFESGMSEDTSPLLSKQNRKLSHNLPLKSAYLS
LGTYLIALLSFWLHAKNLSNLFVVFTFFLAGTPALIKSLDNICQKVVNID
ILMTSAAFGSIFIGGALEGALLLVLFAISEALGQMVSGKAKSTLVSLKQL
APTTGWLVLEDGNLQKVAINKIEVGNILRIKSGEVVPLDGEILHGSSSIN
LMHLTGEKVPKSCHPGSIVPAGAHNMEGSFDLRVLRTGSDSTIAHIINLV
IQAQNSKPRLQQRLDKYSSVYALSIFAIACGIALLVPLFTSIPLLGPQSA
FYRALAFLIAASPCALIIAIPIAYLSAINACAKHGVLLKGGVILDRLVSC
NSVVMDKTGTLTTGELTCIGCDYFGSKNETFFPSVLALEQSSSHPIAEAI
VSYLMEQKVSSLPADRYLTVPGEGVRGYFNEQEAFVGRVETGLGKVPSEY
LEDIEQKIYQAKQHGEICSLAYVGNSFALFYFRDIPRPQAKEIIQDLKDL
GYPVSMLTGDHKVSAENTAEILGISEVFFDLTPEDKLAKIRELATQRQIM
MVGDGINDAPALAQATVGIAMGEAGSATAIEAADIVLLHDSLSSLPWIIQ
KAKQTKKVVSQNLALALAIILLVSWPASLGIIPLWLAVILHEGSTVIVGL
NALRLLKS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCTCCCGTTTGTTTTTCACTTCATTTTCTGCAGAAGTAGTGAATAC
ATTTTTTGAATCAGGGATGTCTGAAGATACGAGTCCCCTTCTATCTAAAC
AAAATCGCAAATTGAGTCACAATCTTCCTTTAAAATCGGCGTATTTATCT
TTAGGGACCTACTTGATTGCTCTTCTAAGTTTCTGGCTCCATGCAAAAAA
TCTCTCTAACTTATTTGTAGTATTTACATTTTTTCTTGCTGGCACTCCTG
CTCTGATTAAGTCGTTAGATAACATATGTCAAAAGGTAGTGAACATTGAT
ATTTTGATGACATCAGCAGCCTTCGGCTCTATTTTTATTGGAGGAGCTTT
AGAAGGAGCCTTGCTTCTTGTCTTGTTTGCGATTTCAGAAGCGTTGGGAC
AGATGGTATCGGGGAAAGCAAAGAGCACTTTAGTCTCTTTGAAGCAGCTC
GCTCCTACTACGGGTTGGCTTGTCTTAGAAGATGGCAACTTACAAAAAGT
CGCAATCAACAAGATTGAGGTTGGAAATATCCTACGCATTAAAAGTGGCG
AGGTTGTGCCTTTGGACGGAGAAATCCTTCATGGTTCTTCTTCTATCAAC
CTCATGCATCTTACTGGAGAAAAAGTTCCTAAATCCTGTCATCCAGGGTC
GATTGTTCCTGCGGGAGCCCATAATATGGAAGGGAGTTTCGATCTTCGTG
TCTTACGTACGGGATCGGATTCTACCATCGCTCATATTATCAATTTAGTC
ATTCAGGCACAGAACTCTAAACCTAGGTTACAGCAACGCTTAGATAAATA
TTCTTCAGTATATGCTCTCTCTATTTTTGCAATTGCCTGTGGAATTGCCC
TTTTGGTTCCTTTATTTACTTCCATTCCATTGTTAGGACCTCAGAGTGCA
TTTTACCGTGCCCTAGCGTTTCTTATTGCAGCGTCTCCGTGTGCTTTGAT
CATTGCGATTCCTATTGCCTATTTAAGTGCTATCAATGCCTGTGCGAAAC
ATGGGGTTCTCCTGAAAGGCGGTGTGATTTTAGATCGTTTAGTTTCTTGT
AATTCTGTAGTGATGGATAAAACGGGAACGTTAACGACTGGCGAGCTTAC
CTGTATAGGTTGCGACTACTTCGGTTCTAAAAATGAGACCTTTTTCCCTT
CAGTATTAGCTTTAGAGCAGTCTTCATCTCATCCGATTGCTGAGGCTATT
GTTTCTTACCTTATGGAGCAGAAGGTATCCTCGCTTCCTGCAGATCGGTA
TCTTACAGTTCCTGGAGAGGGGGTTCGTGGCTATTTCAATGAACAAGAAG
CTTTTGTAGGTCGGGTAGAAACAGGACTAGGGAAGGTGCCTTCTGAGTAT
CTTGAAGATATAGAACAAAAAATTTATCAGGCGAAGCAACATGGGGAGAT
TTGTTCTCTAGCGTATGTTGGGAATAGTTTTGCTCTATTTTATTTTCGAG
ATATTCCTCGTCCTCAAGCTAAAGAAATCATTCAAGATCTCAAAGATCTC
GGCTATCCCGTGAGCATGCTCACGGGAGATCATAAAGTCAGTGCTGAAAA
TACAGCGGAAATTTTAGGAATTTCTGAGGTATTTTTCGATCTCACCCCTG
AGGATAAGTTAGCGAAAATACGCGAGCTTGCAACACAACGTCAAATTATG
ATGGTCGGCGATGGAATTAATGATGCTCCTGCTTTAGCACAAGCTACTGT
AGGCATTGCTATGGGAGAAGCTGGAAGCGCTACAGCAATAGAAGCTGCTG
ATATTGTTCTCCTGCACGACTCCTTGTCGTCCCTCCCTTGGATCATTCAA
AAAGCAAAACAAACGAAAAAAGTTGTTTCGCAGAACCTTGCACTAGCGCT
TGCTATTATTCTTTTAGTCTCCTGGCCTGCATCGTTAGGGATCATTCCTC
TATGGCTCGCGGTAATTCTTCATGAGGGAAGTACGGTGATTGTGGGGTTA
AATGCTCTCCGTTTGCTGAAAAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy