Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR688 IGR691 IGR690 IGR687 birA, - CPn0866 CPn0869 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 birA, - CPn0866 CPn0869 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867 birA, - CPn0866 CPn0869 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 pgmA, - CPn0863 nifU, - CPn0861 pgmA, - CPn0863 nifU, - CPn0861 CPn0865 yjbC, - CPn0864 ribD, - CPn0871 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0867

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rodA  

Definition:
rod-shape determining protein

Gene Start:
983423

Gene Stop:
984670

Gene Length:
1248

Molecular Weight*:
46651

pI*:
9.90

Net Charge*:
17.83

EC:
 

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to rod-shape determining protein; e.g. residues 37-415 are 74% similar to CT726; residues 44-407 are 26% similar to TP0501; residues 117-407 are 23% similar to TP0387; residues 71-411 are 24% similar to RODA_ECOLI; residues 84-411 are 26% similar to RODA_HAEIN; and residues 73-412 are 23% similar to RODA_HELPY.
No significant similarity to M.genitalium, M.pneumoniae, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0772
COG name: Bacterial cell division membrane protein FtsW/MrdB/SpoVE
Functional Class:  D
The phylogenetic pattern of COG0772 is -----QVcEBRHUJ--OLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 138-156, 264-294, 303-324, and 368-404 represent blocks BL00428A-D (Cell cycle proteins ftsW / rodA / spoVE proteins) with a combined E-value of 1.6e-33.

ProDom Summary:  Protein Domain Search
Residues 84-411 are 32% similar to a defined domain of RODA_HAEIN, defined as: CELL PROTEIN DIVISION TRANSMEMBRANE SHAPE FTSW PEPTIDOGLYCAN SYNTHESIS WALL INNER.

Paralogs:  Local Blast Search
One probable paralog. Residues 51-414 are 26% similar to CPn0903, a predicted cell division protein FtsW sequence.

Pfam Summary:  Pfam Search
Residues 47 to 415 (E-value = 5.8e-53) place CPn0867 in the FTSW_RODA_SPOVE family which is described as Cell cycle protein (PF01098)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
93
non-globular  
277  
415

PDB Hit:


Gene Protein Sequence:
MHIGFCHCVRGGNFFYFVINNFHILEIYSLLNSNTIMRYHKYFRYVNSWV
FLVVLTLMLLSVVVISSMDPTAMLVTSSKGLLTNKSIMQLRHFALGWVVF
FICAYFDYHLFKRWAWVLYFFMICALVGLFFVPSVQNVHRWYRIPFIHMS
VQPSEYGKLVIVIMLSYILESRKADITSKTTAFLACLVVALPFFLILKEP
DLGTALVLCPVTLTIFYLSNVHSLLVKFCTVVATIGIIGSLLIFSGIVSH
QKVKPYALKVIKEYQYERLSPSNHHQRASLISIGLGGIRGRGWKTGEFAG
RGWLPYGYTDSVFSALGEEFGLLGLLFTLGLFYCLICFGCRTVAVATDDF
GKLLAAGITVYLAMHVLINISMMCGLLPITGVPLILISYGGSSVISTMAS
LGVLQSIYSHRFAKY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATATAGGATTTTGCCATTGTGTTCGTGGAGGGAATTTCTTCTATTT
CGTAATAAATAACTTTCATATTCTAGAAATTTACAGTCTGCTCAATAGTA
ATACGATTATGAGATATCATAAATATTTTCGGTATGTGAATTCTTGGGTT
TTTCTTGTCGTACTTACCTTAATGCTATTAAGTGTTGTGGTCATTTCTTC
AATGGATCCTACAGCGATGCTGGTGACCTCCTCCAAAGGCCTCTTGACCA
ATAAAAGTATCATGCAGCTCAGGCATTTCGCTCTAGGATGGGTCGTTTTT
TTTATCTGTGCCTACTTCGATTATCACTTATTTAAACGATGGGCATGGGT
ACTCTACTTTTTCATGATTTGTGCTCTCGTGGGCCTTTTTTTTGTTCCGT
CAGTCCAAAATGTCCATAGATGGTACCGTATTCCTTTCATCCATATGAGC
GTACAGCCCTCAGAATATGGAAAGCTTGTGATCGTGATAATGCTCAGTTA
TATCTTGGAATCCCGAAAAGCAGATATTACATCGAAAACAACAGCATTCC
TTGCTTGCTTAGTTGTCGCACTTCCGTTCTTTCTAATTTTAAAAGAGCCT
GATTTAGGAACCGCATTAGTCTTATGTCCTGTGACATTGACGATTTTCTA
TTTAAGTAATGTCCATTCTTTACTAGTAAAATTTTGTACAGTGGTCGCTA
CCATCGGAATTATAGGCTCGTTATTGATTTTTTCAGGAATCGTCTCACAT
CAGAAAGTGAAACCCTATGCTCTGAAAGTCATCAAGGAATATCAATACGA
GCGACTCAGCCCGTCAAATCATCACCAACGCGCGTCTCTCATTTCTATAG
GGCTGGGAGGAATTCGAGGTCGTGGATGGAAAACTGGGGAGTTTGCAGGT
CGTGGATGGCTACCCTACGGCTACACAGACTCTGTATTCTCGGCATTAGG
AGAGGAATTCGGGTTGCTGGGGCTACTCTTTACTCTAGGGCTATTTTATT
GTCTTATCTGTTTTGGTTGTCGAACTGTTGCAGTCGCCACTGATGACTTT
GGAAAACTCCTCGCTGCTGGCATTACCGTATACCTAGCGATGCACGTCTT
AATCAATATTAGCATGATGTGCGGGCTGCTACCTATCACAGGAGTCCCTC
TGATTCTAATTTCCTATGGGGGCTCTTCGGTAATCTCTACAATGGCATCC
CTTGGTGTATTGCAAAGTATCTATAGCCATCGCTTTGCTAAGTACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy