Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR688 IGR690 IGR687 IGR686 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 pgmA, - CPn0863 nifU, - CPn0861 pgmA, - CPn0863 nifU, - CPn0861 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0866

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
birA  

Definition:
biotin synthetase (bifunctional synthetase and repressor)

Gene Start:
983491

Gene Stop:
982913

Gene Length:
579

Molecular Weight*:
21041

pI*:
6.50

Net Charge*:
-1.75

EC:
6.3.4.15  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; biotin  

Pathway: pathway table

Comment:
Forms biotinyl-5'-adenylate and transfers the biotin moiety to proteins
(biotinylation).

Blast Summary:  PSI-Blast Search
CPn0866 is orthologously related to CT725, a predicted biotin ligase: residues
1-175 are 55% similar to CT725. No similarity to T.pallidum, M.genitalium
or U.urealyticum.


COGS Summary:  COGS Search
BeTs to 14 clades of COG0340
COG name: Biotin-(acetyl-CoA carboxylase) ligase
Functional Class: H
The phylogenetic pattern of COG0340 is amtkyqvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 139 (E-value = 6.1e-33) place CPn0866 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
77  
192

PDB Hit:


Gene Protein Sequence:
MKVIYYEIEEIPSTNTMAKSYMHLWDPYALTVISTKCQTAGTGKFGKSWK
SSKGDLLNTFCFFITDLHIDVSRLFRLGTEAVVALCKDLGITEAKIKWPN
DVLVHGEKLCGVLPETLPVEGLLGVVLGIGLNGNTTKQALKDVGQPATSL
QEILGHPIDLETTRELLIHHLLGVLQENLPDSLATKSNRGNI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTATTTATTACGAAATAGAAGAAATTCCCTCCACGAACACAAT
GGCAAAATCCTATATGCATTTGTGGGATCCTTATGCATTAACTGTAATCT
CCACAAAATGTCAAACTGCGGGCACAGGAAAATTTGGTAAAAGCTGGAAA
TCTTCAAAGGGGGATCTTCTTAATACCTTCTGTTTTTTTATTACAGACCT
CCACATCGATGTATCACGTCTCTTTCGCTTAGGCACAGAAGCTGTTGTTG
CCTTATGTAAGGATTTAGGAATTACAGAAGCAAAAATAAAATGGCCTAAC
GATGTCCTGGTTCATGGAGAAAAGCTCTGTGGAGTTCTTCCAGAGACTCT
CCCTGTAGAAGGACTTCTTGGAGTCGTTCTTGGGATCGGCCTCAATGGCA
ATACTACGAAACAAGCTTTAAAAGATGTCGGACAACCTGCAACATCCCTT
CAAGAGATTCTTGGCCATCCCATAGACCTTGAGACTACCAGGGAGCTTCT
TATACACCATCTCCTAGGAGTGTTGCAGGAGAATCTTCCCGATAGCTTAG
CTACTAAATCGAATCGAGGGAACATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy