Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR688 IGR690 IGR687 IGR686 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 serS, - CPn0870 cadA,zntA, - CPn0868 pgmA, - CPn0863 nifU, - CPn0861 pgmA, - CPn0863 nifU, - CPn0861 CPn0869 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0865

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
982418

Gene Stop:
982945

Gene Length:
528

Molecular Weight*:
20313

pI*:
5.20

Net Charge*:
-3.66

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT724, a hypothetical protein sequence. Residues 11-173 are 34% similar to CT724.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
7  
24
transmembrane  
29  
46

PDB Hit:


Gene Protein Sequence:
MGYVFYVIAGSIFLGISLGAYCQLYYSVKSVLFSWYLLTVYALEKRHALL
ALSQLVGEEDAQSQKEIDFLSQCDKLSWRAFLKNSYEIIPTFKEMEDLLS
ERVQGFLESIETIAEHDRAILCIENFWASKNLFDFEIAAYEEAVEKYLKL
RQRAPLRLASKLFRFLDVPSIRFSS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGATATGTTTTCTATGTGATCGCTGGCAGTATATTTCTTGGCATCAG
TTTGGGTGCCTATTGTCAACTCTACTATTCAGTAAAAAGCGTACTATTTT
CTTGGTACTTGTTAACAGTATATGCTTTGGAAAAGCGTCATGCGTTGCTC
GCTCTCTCTCAACTTGTAGGCGAAGAAGACGCCCAGTCCCAAAAGGAAAT
CGACTTTCTCTCGCAGTGTGACAAGCTCTCTTGGCGTGCGTTCCTCAAAA
ATAGCTACGAGATCATCCCAACATTTAAAGAGATGGAAGACCTTCTTTCT
GAAAGAGTGCAGGGATTCCTAGAGTCTATAGAAACGATTGCAGAGCACGA
TCGAGCGATCTTGTGTATCGAAAACTTTTGGGCAAGTAAAAATCTATTTG
ATTTTGAGATTGCAGCTTACGAAGAAGCTGTGGAGAAGTATCTTAAGTTG
CGACAGCGAGCCCCTTTGAGACTTGCCTCAAAGTTGTTCCGCTTTTTAGA
TGTTCCCTCGATTCGATTTAGTAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy