Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR689 IGR685 IGR688 IGR687 IGR686 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 CPn0869 fliF, - CPn0860 yfhO,nifS, - CPn0862 cadA,zntA, - CPn0868 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 pgmA, - CPn0863 nifU, - CPn0861 fliI, - CPn0858 CPn0859 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0864

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yjbC  

Definition:
yjbC, predicted pseudouridine synthase

Gene Start:
981670

Gene Stop:
982377

Gene Length:
708

Molecular Weight*:
25895

pI*:
10.40

Net Charge*:
13.35

EC:
 

Functional Class:
translation; tRNA and rRNA base modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0864 is orthologously related to CT723: residues 1-227 of CPn0864 are 80% similar to residues 1-228 of CT723, a conserved hypothetical protein (basic) (possible pseudouridylate synthetase) from C. trachomatis.
CPn0864 is also similar to TP0459.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1187
COG name: Predicted pseudouridylate synthase family 1
Functional Class: J
The phylogenetic pattern of COG1187 is -----QvCEBrHuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 50 (E-value = 1.8e-11) place CPn0864 in the S4 family which is described as S4 domain (PF01479)
Residues 63 to 193 (E-value = 2.5e-22) place CPn0864 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:


Gene Protein Sequence:
VTKVRLNKFLASAGVASRRKCDEIIFSGSVTVNGRVAEGPFVLVDPEDKV
QVGGTSVHLTKKVYFMVHKAIGYLCSSEKKFPGTKLVIDLFAHLPYRVFT
VGRLDKETSGLILVTNDGEFANKIIHPSSGITKEYLLKVSRDVSAKDLGK
LMEGTFIDGKHVRPVSVTKIRRGTVKIVVSEGKKHEIRLFADAAGFPILE
LKRIRIGSLVLGGLRYGEYRELTDAELGTYMKLSD$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACAAAAGTTCGTCTTAATAAATTTTTAGCTTCTGCGGGAGTTGCTTC
TCGAAGGAAGTGTGATGAAATTATTTTTTCTGGATCCGTGACTGTGAATG
GTCGTGTTGCTGAGGGTCCCTTTGTTCTTGTAGATCCAGAAGATAAAGTA
CAGGTGGGAGGAACCTCTGTTCATCTCACTAAGAAAGTATATTTCATGGT
GCATAAAGCTATCGGGTATCTGTGTTCTTCTGAGAAGAAGTTTCCTGGAA
CTAAGTTGGTGATCGATCTTTTCGCACATCTTCCCTACCGTGTGTTTACT
GTGGGACGTTTGGATAAAGAGACCTCCGGATTAATCTTAGTGACTAATGA
TGGGGAATTTGCAAATAAAATCATTCACCCCTCCTCAGGAATTACCAAAG
AGTATCTTCTAAAAGTTAGCCGCGATGTCTCTGCAAAAGATTTGGGAAAA
TTAATGGAGGGGACTTTCATAGACGGCAAACATGTGCGTCCTGTCTCTGT
GACTAAAATTCGTCGTGGTACAGTAAAGATCGTCGTGAGTGAAGGGAAAA
AACACGAGATCCGGTTGTTTGCAGATGCTGCAGGATTTCCTATTTTAGAG
CTAAAGCGTATCCGTATAGGGAGTTTGGTTTTAGGAGGCTTGCGTTATGG
CGAATATCGCGAGCTTACAGATGCGGAACTCGGGACCTACATGAAATTGT
CTGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy