Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR685 IGR688 IGR687 IGR686 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0863

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgmA  

Definition:
phosphoglycerate mutase

Gene Start:
981514

Gene Stop:
980828

Gene Length:
687

Molecular Weight*:
26232

pI*:
8.40

Net Charge*:
2.65

EC:
5.4.2.1  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis /Gluconeogenesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0863 is similar to TP0168, a predicted
phosphoglycerate mutase in T. pallidum.

CPn0863 is orthologously related to CT722:
residues 1-228 are 75% similar to CT722.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0588
COG name: Phosphoglycerate mutase 1
Functional Class: G
The phylogenetic pattern of COG0588 is ----Y---e-rh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 224 (E-value = 7.4e-60) place CPn0863 in the PGAM family which is described as Phosphoglycerate mutase family (PF00300)

PDB Hit:


Gene Protein Sequence:
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDC
IFTSTLVRSLMTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNM
IPLYQSSALNERMYGELQGKNKKQTAEQFGEERVKLWRRSYKTAPPQGES
LYDTKQRTLPYFEKNILPQLQNGKNVFVSAHGNSLRSLIMDLEKLSEEEV
LSLELPTGKPVVYQWKNHKIEKHPEFFG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTCTTCTTATTTTATTACGTCATGGACAATCTGTATGGAATGAAAA
AAATTTATTTTCTGGATGGGTAGACATTCCTTTAAGCCAACAGGGAATTG
AAGAGGCTTTTTCCGCAGGAAGAGCTATTCAAAATTTGCCTATAGACTGC
ATCTTTACCTCTACCTTAGTACGTAGTCTGATGACCGCCTTACTCGCCAT
GACAAATCATCACTCTAAGAAGATCCCCTATATTGTTCATGAAGATCCCA
AAGCAAAAGAGATGTCGAGGATCTACAGTGCGGAAGAAGAAAACAATATG
ATTCCTCTCTATCAATCTAGTGCCCTCAACGAAAGAATGTACGGCGAACT
TCAAGGAAAAAATAAAAAACAAACAGCCGAACAGTTCGGAGAAGAGCGGG
TCAAGCTGTGGAGGCGCAGCTACAAAACAGCTCCTCCTCAGGGAGAAAGC
CTCTATGATACGAAACAAAGGACCTTGCCTTACTTTGAAAAAAATATTTT
GCCTCAACTGCAAAATGGAAAAAACGTTTTTGTTTCTGCGCACGGAAATT
CCTTACGCTCTTTGATTATGGATCTAGAAAAATTAAGTGAGGAAGAGGTA
CTATCTTTAGAATTACCGACGGGAAAACCAGTTGTATATCAATGGAAAAA
CCACAAAATCGAAAAGCACCCAGAATTTTTTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy