Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR688 IGR687 IGR686 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 cadA,zntA, - CPn0868 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 cadA,zntA, - CPn0868 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0856 CPn0857 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0862

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfhO  nifS  

Definition:
NifS-related protein (aminotransferase?) G

Gene Start:
980873

Gene Stop:
979719

Gene Length:
1155

Molecular Weight*:
42575

pI*:
7.40

Net Charge*:
3.25

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
Most likely belongs to class-V of pyridoxal phosphate-dependent aminotransferases.
See CPn0689.

Blast Summary:  PSI-Blast Search
CPn0862 is orthologously related to CT721: residues 14-383 of CPn0862 are 49% similar to residues 14-383 of CT721, a predicted NifS-related protein (aminotransferase?) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG1104
COG name: Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes (NifS family)
Functional Class:  E
The phylogenetic pattern of COG1104 is A--kYQvCeBRHuj---lINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 21 to 365 (E-value = 2.8e-05) place CPn0862 in the Aminotran_5 family which is described as Aminotransferase class-V (PF00266)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
70  
87
non-globular  
138  
196
transmembrane  
199  
216
transmembrane  
234  
251

PDB Hit:


Gene Protein Sequence:
MEKPQNRKAPRIFWLNNQVAIPPSERVKESYALHSDIFSLPPGSALKLAE
KTEESIRQLVGLKDSHIFRFVPHFPHVVHIVLAALVENLSMFQGRNHIIL
PAHDQQLLINSLCRHQGLGTTYDWVTVNHEGRIVEEQLIETLSPRSLLFS
LSAAHGLTGVIQPLDPLLSLCKDRRILLHLDISDILGRAPLTPEILNADI
ITFSSAALGGMGSIGGIFIRKSLERVFSSWFPPHTSASLCFSAVAAMQTA
CEERISALPLFTFHTSNLCKKLIQELQSVLPSIQLAFSEVQNRLPNIVVA
AIPDIPAESLAFHLHQQGIYPSLGYERFQPLAQVLQNCGISPFLCHSALH
FSLTERSKDLEFSKLARAMHDAIKHLTPLLGSSS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAACCACAAAATCGAAAAGCACCCAGAATTTTTTGGTTAAACAA
CCAAGTCGCTATTCCTCCTTCTGAGCGGGTTAAAGAAAGTTATGCCCTAC
ACTCGGACATATTTTCTCTACCCCCCGGCTCCGCGTTAAAATTAGCTGAG
AAAACAGAGGAGAGTATCCGACAGTTGGTCGGATTGAAAGACTCTCATAT
TTTTCGTTTTGTCCCTCATTTCCCTCATGTGGTTCATATAGTCCTGGCAG
CCCTTGTAGAAAATCTGTCCATGTTTCAAGGAAGAAATCACATCATTCTT
CCTGCTCATGATCAACAGCTTTTAATTAATAGCCTATGTCGCCATCAAGG
ACTCGGAACTACCTATGACTGGGTAACAGTAAATCACGAAGGTAGGATTG
TTGAAGAACAGCTTATAGAAACCTTGAGTCCACGTAGTTTGTTATTCTCA
CTATCTGCAGCTCATGGATTGACAGGGGTAATCCAACCCTTAGATCCTCT
GCTCTCCTTATGCAAAGACCGCAGAATCCTCCTTCACTTGGATATTTCTG
ACATTTTAGGAAGAGCTCCTCTAACTCCTGAGATCCTCAACGCTGACATC
ATTACTTTCTCTTCAGCAGCTCTTGGAGGTATGGGCTCTATCGGGGGGAT
CTTCATTCGTAAATCTTTAGAGAGGGTCTTTTCTTCCTGGTTTCCACCTC
ACACTTCAGCATCTTTATGTTTCAGTGCGGTGGCAGCAATGCAAACTGCG
TGTGAAGAACGTATTTCCGCTCTTCCGCTTTTCACATTCCACACCTCCAA
TTTGTGTAAAAAGCTAATTCAAGAGTTACAAAGCGTCCTCCCCTCAATCC
AATTGGCATTTTCCGAGGTCCAGAACCGATTACCTAATATCGTTGTTGCT
GCAATTCCTGACATCCCAGCAGAGAGTCTTGCCTTCCATCTCCACCAGCA
AGGCATCTATCCATCCTTAGGATACGAGAGATTCCAGCCCCTAGCTCAAG
TGTTACAAAATTGTGGGATCTCCCCGTTCTTATGTCACAGTGCCTTACAT
TTCTCTCTTACAGAAAGAAGTAAAGACCTCGAGTTTTCCAAACTTGCTCG
TGCCATGCATGATGCCATTAAGCATCTTACCCCTTTACTTGGAAGTTCCT
CATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy