Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR688 IGR687 IGR686 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0865 yjbC, - CPn0864 rodA, - CPn0867 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 CPn0865 yjbC, - CPn0864 rodA, - CPn0867
* Calculated from Protein Sequence

Gene ID: CPn0861

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nifU  

Definition:
conserved hypothetical nifU-like protein (acidic)

Gene Start:
979722

Gene Stop:
978922

Gene Length:
801

Molecular Weight*:
29455

pI*:
4.60

Net Charge*:
-15.15

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0861 is orthologously related to CT720: residues 1-261 of CPn0861 are 53% similar to residues 1-258 of CT720, a predicted conserved hypothetical nifU-like protein (acidic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0822
COG name: NifU homologs involved in Fe-S cluster formation
Functional Class:  C
The phylogenetic pattern of COG0822 is A---Yqv-ebrhujgp-linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 152 (E-value = 6e-08) place CPn0861 in the NifU_N family which is described as NifU-like N terminal domain (PF01592)
Residues 189 to 257 (E-value = 4.2e-09) place CPn0861 in the NifU family which is described as NifU-like domain (PF01106)

PDB Hit:


Gene Protein Sequence:
MTLPLEPMIFWSSLSAKVMKKFLTPHCAGTFSEEDAEAKEAHLVTGKQGH
RLMGNCVTFYWLVDKKNGVILDAKFQYFGHPYLIPLAEAVCNLVCGKSYS
EAYKMTLDDIDKSLRVHAHQPALPEDSISLYHFVIDALDTAVEQCLEIPL
EDGSLPLQNSPMNLDFEDANPYSQSDWEALTHEQKLYALRATIAEKIGPY
IAMDGGEVTVESLENFIVTIAYSGNCSGCPSSLGSTLNSIGQLLRAYIYP
ELQVKVDESSLNLSHP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCTACCTCTAGAACCAATGATTTTTTGGTCCTCGCTATCAGCAAA
AGTTATGAAAAAATTCCTTACACCACATTGTGCGGGCACGTTTTCTGAAG
AGGATGCTGAAGCTAAAGAAGCACATCTGGTCACTGGAAAACAGGGGCAC
AGACTGATGGGCAACTGCGTCACTTTTTATTGGCTTGTGGATAAGAAAAA
TGGCGTAATCCTGGATGCAAAATTCCAATACTTTGGTCACCCTTATCTAA
TCCCACTAGCGGAGGCTGTCTGCAATCTTGTTTGTGGGAAAAGCTATAGC
GAAGCTTACAAGATGACTCTTGATGATATTGATAAATCCTTACGCGTACA
CGCACACCAACCCGCTCTTCCTGAAGATAGCATCTCGCTATACCATTTTG
TTATTGATGCCTTAGATACAGCTGTTGAGCAATGTCTTGAAATCCCCTTA
GAGGATGGCTCGCTTCCTTTGCAAAATTCTCCCATGAACCTTGATTTCGA
AGACGCGAATCCCTATAGCCAGAGTGATTGGGAAGCTCTCACTCACGAAC
AAAAGCTCTATGCTCTTCGCGCTACAATAGCAGAAAAAATCGGCCCTTAC
ATTGCTATGGACGGAGGTGAAGTAACTGTAGAATCCCTAGAAAACTTTAT
TGTCACAATTGCCTATTCTGGGAATTGTTCTGGATGTCCTTCGTCATTAG
GATCTACTTTAAATTCCATAGGGCAGCTCCTAAGAGCCTATATCTACCCT
GAACTTCAAGTGAAGGTAGATGAATCATCATTAAATCTTTCTCACCCGTA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy