Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR688 IGR687 IGR686 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0865 yjbC, - CPn0864 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0865 yjbC, - CPn0864 birA, - CPn0866 fliF, - CPn0860 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 gpdA  gpsA, - CPn0855 CPn0865 yjbC, - CPn0864
* Calculated from Protein Sequence

Gene ID: CPn0860

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fliF  

Definition:
probable flagellar M-ring protein

Gene Start:
978630

Gene Stop:
977605

Gene Length:
1026

Molecular Weight*:
38247

pI*:
9.70

Net Charge*:
9.52

EC:
 

Functional Class:
cellular processes; secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0860 is similar to TP0400, a predicted
flagellar moter switch protein in T. pallidum.

CPn0860 is orthologously related to CT719:
residues 18-340 are 45% similar to residues
18-333 of CT719.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1536
COG name: Flagellar motor switch protein FliG
Functional Class:  N
The phylogenetic pattern of COG1536 is -----qv-eb--uj--OLin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
34
transmembrane  
253  
271
non-globular  
272  
341

PDB Hit:


Gene Protein Sequence:
VFFQNLAKKLTALGISPLGCLLIGGVVSCAILFGRSSNPSLAPTQVKTEK
TSGNWLKLTQMGNPKLIESLTKKEQLEKDLTSFHPIASAKVAIALSTEDD
VMSPLHLSVILTLRKEESLTPSLLFSITDYLCSSLPGLKREHISLSDNLG
NLYIPESITVNSLFIHTLENYLGKIFPKEHFALAYHAKAEKPTLQLTLNE
NYIAHLTKEESEKIVAHTKHYLYQNYDDSYDIVIETLPFARLQNKKSFPA
KVLIGSMILVISLMIVALASFYLARHAYERVSPEPRKIKRGINISKLLEI
IQKESPEKIALILSYLDPKKAEALLNRLPEDLKHQVLKYKL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTTTTTCAAAATTTGGCAAAAAAACTTACCGCTTTGGGGATTTCTCC
CCTAGGATGCCTATTAATAGGTGGGGTGGTGAGTTGTGCTATTTTATTTG
GAAGATCCTCGAACCCATCCTTAGCCCCTACTCAAGTTAAAACAGAAAAA
ACTTCTGGCAATTGGCTGAAGCTCACACAAATGGGGAACCCCAAGCTCAT
AGAATCTCTAACAAAAAAAGAGCAGTTAGAAAAAGATCTGACCTCCTTCC
ATCCCATTGCATCTGCAAAAGTTGCCATTGCTCTGTCTACAGAAGATGAC
GTCATGTCTCCTCTGCATCTCTCTGTCATTCTTACTTTAAGAAAAGAAGA
GTCCCTAACTCCTTCACTACTCTTCTCAATTACAGACTATCTATGCAGCA
GTCTTCCTGGGTTGAAACGAGAACATATATCCCTATCTGACAACTTAGGG
AACCTCTATATTCCTGAATCTATAACTGTAAATTCTCTGTTCATCCATAC
ATTAGAAAATTACCTGGGGAAAATTTTCCCCAAGGAACACTTTGCTCTTG
CGTATCACGCAAAAGCAGAGAAGCCCACATTACAGCTCACTTTAAATGAA
AATTATATTGCTCATTTAACCAAAGAAGAATCCGAAAAGATTGTAGCCCA
TACTAAACACTACCTCTATCAAAACTATGACGACTCCTATGATATTGTCA
TAGAAACCCTCCCTTTCGCTCGTTTACAGAATAAAAAATCGTTCCCAGCA
AAAGTTCTAATCGGGAGTATGATTCTTGTCATAAGCTTGATGATTGTTGC
TTTAGCTAGTTTCTACCTCGCAAGACACGCTTATGAGAGAGTCTCCCCCG
AACCTAGGAAAATAAAACGAGGCATAAATATCTCAAAGCTGTTAGAGATT
ATACAAAAGGAATCTCCAGAAAAAATAGCTTTAATTCTTTCGTACCTGGA
CCCTAAGAAAGCAGAAGCCTTATTAAACAGATTACCCGAAGATCTCAAAC
ATCAAGTGCTGAAATATAAACTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy