Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR683 IGR687 IGR686 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 yjbC, - CPn0864 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 yjbC, - CPn0864 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 pgmA, - CPn0863 nifU, - CPn0861 gpdA  gpsA, - CPn0855 yjbC, - CPn0864
* Calculated from Protein Sequence

Gene ID: CPn0859

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
977588

Gene Stop:
977052

Gene Length:
537

Molecular Weight*:
20281

pI*:
6.10

Net Charge*:
-5.45

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT718, a hypothetical protein. Residues 6-177 are 52% similar to CT718.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1317
COG name: Flagellar assembly protein FliH
Functional Class:  N
The phylogenetic pattern of COG1317 is ------v-eb--uj--olin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
133

PDB Hit:


Gene Protein Sequence:
VTTPQSPGSLSQSHLPHPHDPWDTEPTSLPEDPNDKASQELHSLVHLFRK
LSIHLLSEVEKTVQQLKPDLLELALLICEKFLYKKLENPQELALLLSTAL
QRHTTLRSLTPIKVFLHPEDLKTLTDWISTHELPMIKHAEFFPDTSCRRS
GFKIETPNGILRQEISEELDHLLSVLTA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACAACACCACAATCTCCTGGTTCGCTTTCTCAATCTCACCTTCCTCA
TCCACATGATCCTTGGGATACAGAACCTACAAGTCTTCCCGAAGATCCGA
ATGATAAGGCAAGCCAAGAACTCCATTCGTTAGTTCATCTCTTTCGCAAG
CTATCCATTCACCTACTTAGTGAAGTCGAAAAAACAGTACAACAGCTAAA
ACCCGACCTACTAGAACTGGCTCTTCTCATCTGTGAAAAATTTCTCTATA
AGAAGCTAGAAAATCCTCAAGAACTGGCCCTGCTCCTCTCTACCGCGCTC
CAAAGACATACGACATTAAGATCTCTGACTCCCATCAAAGTATTTCTCCA
TCCCGAGGATCTCAAAACACTTACAGATTGGATCTCCACCCACGAACTCC
CCATGATTAAGCATGCTGAGTTTTTCCCTGACACTTCTTGTAGACGATCA
GGATTCAAAATAGAAACCCCTAACGGAATTCTGAGACAAGAAATCAGCGA
AGAACTAGACCATCTACTTTCTGTTTTGACAGCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy