Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR682 IGR683 IGR686 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 fliF, - CPn0860 ompB, - CPn0854 yfhO,nifS, - CPn0862 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 nifU, - CPn0861 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 nifU, - CPn0861 gpdA  gpsA, - CPn0855 CPn0852 CPn0853
* Calculated from Protein Sequence

Gene ID: CPn0857

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
975757

Gene Stop:
975389

Gene Length:
369

Molecular Weight*:
14705

pI*:
10.70

Net Charge*:
10.67

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single significant hit in gapped BLAST to CT716, a conserved hypothetical protein. Residues 1-114 are 33% similar to CT716.
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
64  
109

PDB Hit:


Gene Protein Sequence:
MRDRLGSLSLILKVKIHKYLDTLHNQKRLALTVSRNIQATNKRIADLHLE
RYEHFISRDNIKHYDILLEYLKTLQSSLYKQQSESLRFLEIHHQQLQELI
NRRKIIEKIKNNKYSKDQEIGT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGATCGACTTGGGAGCCTATCTTTAATCTTAAAAGTAAAAATCCA
TAAATATTTAGATACCCTTCATAATCAGAAGCGCTTAGCTTTAACAGTAT
CACGAAATATTCAAGCTACAAATAAAAGGATTGCTGATTTACACCTGGAA
CGTTATGAGCATTTTATTTCTCGAGATAACATAAAACATTATGATATACT
CCTAGAATACTTAAAAACATTACAATCATCTCTTTATAAACAACAGAGCG
AATCTCTTCGCTTTCTTGAAATCCATCACCAACAACTCCAGGAATTAATA
AACCGCAGAAAAATCATCGAAAAGATCAAGAACAATAAGTATTCTAAGGA
TCAAGAGATAGGAACGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy