Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR682 IGR683 IGR686 nifU, - CPn0861 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 nifU, - CPn0861 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 nifU, - CPn0861 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0853 CPn0852
* Calculated from Protein Sequence

Gene ID: CPn0856

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
UDP-glucose phosphorylase

Gene Start:
975377

Gene Stop:
973992

Gene Length:
1386

Molecular Weight*:
51979

pI*:
6.60

Net Charge*:
-3.84

EC:
2.7.7.9  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Galactose metabolism
Nucleotide sugars metabolism
Pentose and glucuronate interconversions
Starch and sucrose metabolism

Comment:
A potential glucosyl donor in several pathways: pentose, galactose, nucleotide sugars, etc.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to UDP-glucose pyrophosphorylase sequences; e.g. residues 1-461 are 63% similar to CT715, a predicted UDP-glucose pyrophosphorylase; residues 8-405 are 29% similar to (AC004238) unknown protein [Arabidopsis thaliana]; and residues 16-411 are 28% similar to (AB011003) UDP-N-acetylglucosamine pyrophosphorylase [Candida albicans].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 211-405 are 30% similar to a defined domain of O64765_ARATH, defined as: PROTEIN F19I3.25 C36A4.4 SIMILARITY HUMAN AGX-1 ANTIGEN PHO2-POL3 INTERGENIC REGION.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 40 to 446 (E-value = 9.9e-08) place CPn0856 in the UDPGP family which is described as UTP--glucose-1-phosphate uridylyltransferase (PF01704)

PDB Hit:


Gene Protein Sequence:
MTESVYSPSAMHVNSLADKLKAINQEHILDIWPSLSPKQQQRLFQQLTSV
DIDFFRKQQQLLSSPTAILKDFHPITSFASSGEDPERAHAGTTLLKEKKV
ACVVLAGGQGSRLKCDGPKGLFPVSPIKKKPLFQLVAEKVRAASKLAGQP
LPLAFMTSPLNTRQTRSFFESNDYFHLDPNQVDFFCQPLWPLLTLSGDLF
LEDMDTLALGPNGNGCIATLLYTSGVWEKWKNAGIEMVSVIPIDNPLALP
FDVELCGFHAMSNNEVTIKAALRQTAIEDVGILVKSHDSGKTSVIEYSEI
PQNERFALNEDGKLKYCLANIGLYCLSMDFIRHAAYQQLPLYKVHKHAKQ
LGHTSLNEKNAWKFEEFIFDLFCYSDHCQTLVYPRQECFAPLKNLEGNHS
PDTVRQALSDRERQLFHKVTGKKLSPNTTFELEADFYYPSTSTSLHWENK
AFFEEPFFEAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGAATCGGTATATTCGCCCTCTGCTATGCATGTAAACTCTCTAGC
AGATAAGCTCAAAGCCATAAATCAAGAACATATATTAGATATCTGGCCCT
CCCTTTCTCCAAAACAACAACAAAGACTTTTTCAGCAGCTCACCTCTGTA
GATATTGATTTTTTTCGTAAGCAACAGCAACTGCTTTCCTCACCAACAGC
AATTCTTAAAGATTTTCATCCGATAACGTCATTTGCCTCTTCAGGAGAAG
ATCCAGAACGAGCTCATGCAGGAACTACGCTACTTAAAGAGAAAAAAGTT
GCCTGTGTAGTCCTGGCAGGGGGACAAGGCTCAAGATTGAAGTGCGATGG
CCCTAAAGGGTTATTCCCTGTTTCTCCTATTAAAAAGAAGCCGCTGTTTC
AGTTGGTAGCAGAAAAGGTACGTGCTGCAAGTAAACTTGCAGGTCAACCT
CTTCCTCTAGCATTCATGACCTCTCCTTTGAATACCCGACAAACACGTTC
TTTTTTTGAATCCAACGACTACTTCCACCTAGATCCAAATCAGGTGGATT
TTTTCTGCCAACCACTTTGGCCCCTCCTCACCCTATCTGGAGACCTATTT
CTTGAAGATATGGACACTCTAGCTCTTGGTCCGAATGGCAACGGTTGTAT
AGCTACCCTTCTCTATACTTCAGGAGTATGGGAGAAATGGAAAAATGCTG
GCATAGAAATGGTAAGTGTGATCCCCATTGACAATCCTTTAGCGCTTCCT
TTTGACGTAGAACTCTGTGGATTCCATGCGATGTCTAACAACGAGGTAAC
CATAAAAGCGGCTCTACGTCAAACTGCTATTGAAGATGTGGGTATTCTTG
TAAAATCTCATGATTCTGGAAAAACTTCTGTTATCGAATACTCTGAAATT
CCCCAAAACGAGAGATTCGCTCTTAATGAAGATGGAAAATTAAAATACTG
CCTTGCAAATATCGGTCTTTACTGTCTCTCCATGGACTTTATCCGCCACG
CCGCCTACCAACAGCTGCCCCTGTATAAAGTCCACAAGCATGCCAAGCAA
CTAGGCCATACCTCCTTAAATGAGAAAAATGCTTGGAAATTTGAAGAGTT
TATCTTTGATCTATTTTGTTATAGCGACCATTGTCAAACTCTTGTGTATC
CTAGACAAGAGTGCTTTGCTCCCCTAAAAAATCTGGAGGGCAATCATAGC
CCCGATACAGTAAGACAAGCTCTCTCTGACCGAGAGCGCCAACTCTTCCA
CAAAGTCACAGGAAAAAAGCTCTCTCCTAACACAACATTTGAATTAGAAG
CTGATTTTTATTATCCTTCAACATCAACTTCCCTACATTGGGAAAACAAA
GCATTTTTCGAGGAACCATTTTTTGAGGCCTCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy