Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR684 IGR685 IGR682 IGR683 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0853 CPn0852 fliF, - CPn0860 ompB, - CPn0854 fliI, - CPn0858 CPn0856 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0857 CPn0859 gpdA  gpsA, - CPn0855 CPn0853 CPn0852
* Calculated from Protein Sequence

Gene ID: CPn0855

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gpdA gpsA  

Definition:
glycerol-3-phosphate dehydrogenase

Gene Start:
973995

Gene Stop:
972991

Gene Length:
1005

Molecular Weight*:
36148

pI*:
7.40

Net Charge*:
1.65

EC:
1.1.1.8  1.1.1.94  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
CPn0855 is similar to TP1009 in T. pallidum
and UU382 in U. urealyticum.

CPn0855 is orthologously related to CT714 and
they share 72% similarity.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0240
COG name: Glycerol 3-phosphate dehydrogenase
Functional Class:  C
The phylogenetic pattern of COG0240 is a-t-YqvcebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 324 (E-value = 5.4e-163) place CPn0855 in the NAD_Gly3P_dh family which is described as NAD-dependent glycerol-3-phosphate dehydrogenase (PF01210)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
189  
206

PDB Hit:


Gene Protein Sequence:
MKQHIGYLGMGIWGFCLASLLANKGYPVVAWSRNPDLIKQLQEERRHPLA
PNVVISPNLSFTTDMKEAIHNAFMIVEGVTSAGIRPVAEQLKQITDLSVP
FVITSKGIEQNTGLLLSEIMLEVLGDSVTPYLGYLSGPSIAKEVLNGSPC
SVVVSAYDSQTLKQIHEAFSLPTFRVYPNTDIKGAALGGALKNVIAIACG
IAEGLSFGNNAKAGLVTRGLHEMRKLAAIMDCKPETLNGLAGLGDLCVTC
FSESSRNLRFGHLLAQGLTFEQAKAKIGMVVEGAYTALSAYQVAKHHKID
MPITTGIYRVLYENLDLKEGIALLLQRNTKEEFL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAACACATCGGCTACTTAGGTATGGGAATTTGGGGGTTTTGTCT
AGCCTCCCTACTTGCGAATAAGGGATATCCTGTTGTGGCATGGTCCCGGA
ACCCTGACCTAATCAAGCAATTACAAGAAGAACGACGTCATCCTTTAGCT
CCCAATGTTGTCATCTCTCCAAACCTTTCATTCACTACAGACATGAAAGA
AGCGATCCACAATGCTTTCATGATTGTAGAAGGAGTGACCTCCGCAGGAA
TCCGTCCCGTAGCAGAGCAATTAAAACAAATCACTGACCTCTCGGTCCCC
TTTGTAATTACCTCTAAGGGAATCGAGCAAAATACAGGACTCCTCCTCAG
TGAAATCATGCTCGAAGTGCTTGGAGATTCCGTGACTCCATATTTAGGGT
ATCTCAGTGGTCCTTCCATCGCTAAAGAGGTCCTAAACGGTTCTCCCTGT
TCTGTCGTAGTCAGCGCTTACGATTCACAAACTCTCAAACAAATCCACGA
AGCTTTTTCCCTCCCCACCTTCCGAGTCTACCCTAATACCGATATTAAAG
GTGCTGCTCTCGGAGGAGCTTTGAAAAATGTGATTGCTATTGCCTGTGGG
ATTGCTGAGGGATTATCGTTTGGAAACAATGCAAAAGCAGGCCTTGTGAC
CCGGGGATTGCATGAAATGCGTAAACTCGCCGCTATCATGGATTGTAAAC
CAGAAACTCTAAATGGCCTTGCAGGTCTTGGAGATCTTTGTGTTACCTGC
TTCTCAGAGTCGAGTCGGAATTTACGGTTCGGGCACCTTCTTGCTCAAGG
TCTTACTTTCGAACAAGCAAAAGCAAAAATTGGGATGGTAGTCGAAGGAG
CCTACACAGCACTTTCTGCATACCAAGTCGCCAAACATCATAAAATCGAT
ATGCCCATCACTACGGGAATCTATCGCGTTCTCTATGAAAATCTTGATCT
CAAAGAGGGCATTGCTCTCCTCTTACAGAGAAATACAAAAGAAGAGTTCC
TATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy